Recombinant Schizosaccharomyces pombe UPF0494 membrane protein C977.06 (SPAC977.06)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional charges apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
SPAC977.06; UPF0494 membrane protein C977.06
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC977.06
Target Protein Sequence
MVRDTRNVDLERGLELCKPEKVNKQNLFTNIIKPQKDKINIKTDKIKFFLNNLFTEFSKF HDSCYPDGRISTRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSIWINESFINENRFYSEI WGPIAIYICLFVLLLLGLIYCSKIVVKAIPLISIVIAAVVVIIAVAMVKILYICHWLLQN FNFGFRHKS
Uniprot No.

Target Background

Database Links
Protein Families
UPF0494 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does S. pombe serve as a model for studying membrane proteins like SPAC977.06?

S. pombe has become an important model organism for several reasons when studying membrane proteins:

  • Genetic tractability - The haploid nature of S. pombe facilitates genetic manipulation and phenotypic analysis

  • Conserved cellular processes - Many membrane-associated functions are conserved between yeast and higher eukaryotes

  • Complete genome annotation - The fully sequenced genome allows comprehensive analysis of gene function and interaction networks

  • Advanced tools available - Techniques such as endogenous tagging have been successfully employed across the proteome

A significant advantage of using S. pombe is that approximately 70% of its genes have human orthologs, including many involved in human disease. This makes findings from studying proteins like SPAC977.06 potentially translatable to human biology .

Are there human orthologs of SPAC977.06 with clinical significance?

While the search results don't specifically identify human orthologs of SPAC977.06, researchers can utilize orthology prediction tools such as HCOP (HGNC Comparison of Orthology Predictions) to identify potential human counterparts . The high degree of conservation between S. pombe and humans (approximately 70% of genes) suggests possible orthologous relationships.

The identification of human orthologs would be particularly valuable given that:

  • Membrane proteins represent approximately 60% of current drug targets

  • Understanding the function of conserved membrane proteins can provide insights into human disease mechanisms

  • Structural and functional characterization in model organisms often translates to therapeutic applications

Researchers should perform sequence similarity searches and consult orthology databases to identify human proteins that may share functional characteristics with SPAC977.06.

What are optimal conditions for reconstituting recombinant SPAC977.06 protein?

For optimal reconstitution of recombinant SPAC977.06, follow these evidence-based protocols:

  • Begin with a brief centrifugation of the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Create multiple small aliquots to avoid repeated freeze-thaw cycles, which can damage protein structure

  • Store working aliquots at 4°C for up to one week; store long-term aliquots at -20°C/-80°C

The product is typically supplied in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For membrane proteins like SPAC977.06, consider additional stabilization with mild detergents or reconstitution into lipid vesicles to maintain native conformation.

How should researchers design experiments to study SPAC977.06 function?

Designing robust experiments to study SPAC977.06 requires systematic consideration of several key factors:

Experimental Design ElementImplementation for SPAC977.06
Independent VariablesGenetic manipulation (knockout, overexpression), environmental conditions, stress induction
Dependent VariablesCellular phenotypes, protein localization, interaction profiles, membrane integrity
Control GroupsWild-type S. pombe, empty vector controls, unrelated membrane protein controls
Replication StrategyMinimum 3 biological replicates, multiple technical replicates
Statistical AnalysisAppropriate tests based on data distribution, multiple testing correction

The experimental design should follow these core principles:

  • Begin with clear, testable hypotheses about SPAC977.06 function

  • Select appropriate treatments to manipulate your independent variables

  • Determine optimal assignment of subjects to experimental groups

  • Establish precise methods to measure dependent variables

  • Implement controls for extraneous variables that might influence results

Advanced approaches might include creating conditional mutants to study essential functions or employing complementation studies with human orthologs to assess functional conservation.

What tagging strategies are most effective for studying SPAC977.06 localization?

For membrane proteins like SPAC977.06, tagging strategy selection is critical to maintain protein function while enabling visualization:

  • Endogenous tagging: This approach preserves native expression levels and has been successfully used in creating comprehensive libraries of tagged S. pombe proteins. For SPAC977.06, this would involve modifying the genomic locus to express the tagged protein .

  • Tag position considerations:

    • C-terminal tags are often preferred for membrane proteins to avoid disrupting signal sequences

    • Internal tags may be placed in predicted loop regions between transmembrane domains

    • Multiple tagging approaches should be validated to confirm consistent localization patterns

  • Optimal tag selection:

    • Fluorescent proteins: GFP or mCherry for live imaging studies

    • Epitope tags: HA, FLAG or Myc for immunofluorescence or biochemical studies

    • Split tags: For protein interaction studies using complementation approaches

  • Validation requirements:

    • Confirm protein functionality is maintained with the tag

    • Compare localization using orthogonal methods

    • Verify expression levels match untagged protein

Recent research has demonstrated successful endogenous tagging of 89 S. pombe transcription factors, proving the effectiveness of genomic tagging approaches in this organism .

What analytical techniques are most informative for characterizing SPAC977.06?

Multiple analytical techniques can provide complementary information about SPAC977.06:

TechniqueApplication for SPAC977.06Key Insights
Immunoprecipitation-MSIdentify protein interaction partnersReveals protein complexes and potential functions
ChIP-sequencingDetect potential DNA associationsIdentifies if the protein has chromatin interactions
Fluorescence microscopyVisualize subcellular localizationDetermines membrane localization patterns
RNA-seqAnalyze transcriptional impactsIdentifies genes affected by SPAC977.06 manipulation
Membrane fractionationIsolate specific membrane compartmentsDetermines specific membrane localization
LipidomicsIdentify associated lipidsReveals lipid preferences that may indicate function

Researchers studying transcription factors in S. pombe have successfully employed immunoprecipitation-mass spectrometry and ChIP-sequencing to map protein and chromatin interactions, discovering DNA-binding sites across 2,027 unique genomic regions . Similar approaches could reveal if SPAC977.06 has unexpected associations with nuclear processes.

For temporal expression analysis, the MultiRNAflow R package has been specifically developed for integrated analysis of time-course RNA-seq data in organisms including S. pombe .

How might SPAC977.06 relate to transcriptional regulation in S. pombe?

While SPAC977.06 is classified as a membrane protein rather than a transcription factor, recent research in S. pombe has revealed unexpected connections between membrane proteins and transcriptional regulation:

  • A comprehensive study created a library of 89 endogenously tagged S. pombe transcription factors (TFs), mapping their protein and chromatin interactions using immunoprecipitation-mass spectrometry and ChIP-sequencing

  • This research identified protein interactors for half the TFs studied, with over 25% potentially forming stable complexes

  • The study discovered DNA-binding sites for most TFs across 2,027 unique genomic regions, revealing motifs for 38 TFs and uncovering a complex network of extensive TF cross- and autoregulation

  • A specific heterodimer, Ntu1/Ntu2, was linked to perinuclear gene localization, demonstrating connections between nuclear periphery proteins and gene regulation

To investigate potential roles of SPAC977.06 in transcriptional processes, researchers should:

  • Determine if SPAC977.06 physically interacts with any known transcription factors

  • Analyze if SPAC977.06 deletion affects the expression of specific gene sets

  • Investigate if SPAC977.06 localizes to the nuclear membrane or endoplasmic reticulum

  • Examine potential roles in perinuclear gene organization using advanced imaging techniques

What roles might SPAC977.06 play in cellular responses to stress?

S. pombe is an important model organism for studying cellular responses to DNA damage and stress . While the specific role of SPAC977.06 in these processes isn't directly established in the search results, several research approaches can elucidate potential functions:

  • Stress response phenotyping:

    • Compare growth of wild-type and SPAC977.06 deletion strains under various stress conditions

    • Analyze sensitivity to DNA damaging agents (UV, MMS, hydroxyurea)

    • Examine responses to membrane stressors (detergents, osmotic changes)

    • Evaluate cell cycle checkpoint activation in response to damage

  • Molecular response characterization:

    • Monitor changes in SPAC977.06 expression, localization, or post-translational modifications during stress

    • Identify potential stress-related interaction partners through IP-MS under stress conditions

    • Analyze membrane dynamics and integrity in response to stress in wild-type vs. mutant cells

  • Integration with known pathways:

    • Test for genetic interactions with established stress response genes

    • Investigate if SPAC977.06 affects signaling between membranes and the nucleus during damage response

    • Examine if SPAC977.06 is involved in stress granule formation or membrane remodeling

The connection between membrane proteins and stress response is an emerging area of research, with membrane proteins potentially serving as sensors or mediators of stress signaling pathways.

How can computational approaches advance our understanding of SPAC977.06?

Computational methods offer powerful approaches for investigating SPAC977.06 function:

  • Structural prediction and analysis:

    • Modern AI-based tools can predict the 3D structure of SPAC977.06 with increasing accuracy

    • Molecular dynamics simulations can reveal conformational changes in different membrane environments

    • Ligand binding site prediction may identify potential functional sites

  • Systems biology integration:

    • Network analysis can place SPAC977.06 in the context of known cellular pathways

    • Guilt-by-association approaches can predict function based on interaction partners

    • Cross-species comparative analysis can identify evolutionarily conserved features

  • Machine learning applications:

    • Feature extraction from sequence data to identify functional domains

    • Classification models to predict subcellular localization

    • Text mining of scientific literature to generate functional hypotheses

  • Time-series analysis for expression data:

    • The MultiRNAflow R package provides specialized tools for analyzing temporal RNA-seq data in S. pombe

    • This enables identification of expression patterns across different biological conditions over time

    • Statistical models specifically designed for time-series data can reveal dynamic behaviors

These computational approaches can generate testable hypotheses about SPAC977.06 function that guide experimental design.

What methodological challenges arise when studying membrane proteins like SPAC977.06?

Membrane proteins present unique experimental challenges that require specialized approaches:

ChallengeImpact on SPAC977.06 ResearchMitigation Strategies
HydrophobicityDifficult expression, purification, and handlingUse specialized expression systems, detergents, or nanodiscs
Native conformationLoss of function outside lipid environmentReconstitute in liposomes or membrane mimetics
Low natural abundanceDifficult detection of endogenous proteinDevelop sensitive detection methods or controlled overexpression
Dynamic behaviorTransient interactions may be missedUse crosslinking or proximity labeling approaches
Multiple conformationsFunction may depend on specific statesStudy under various conditions that stabilize different states
Transmembrane topologyChallenging to determine orientationUse accessibility assays or topology reporters

When designing experiments with SPAC977.06:

  • Consider the impact of tags on membrane insertion and topology

  • Validate that recombinant protein maintains native conformation

  • Develop assays that can function in membrane environments

  • Use complementary approaches to confirm findings

  • Include appropriate controls specific to membrane protein research

Addressing these challenges requires multidisciplinary approaches combining biochemistry, cell biology, and structural biology techniques.

How should researchers analyze temporal expression patterns of SPAC977.06?

Analyzing temporal expression patterns of SPAC977.06 requires specialized approaches for time-series data:

  • Appropriate tools for S. pombe time-course studies:

    • The MultiRNAflow R package is specifically designed for integrated analysis of temporal RNA-seq data in organisms including S. pombe

    • This package can analyze transcriptional responses across different biological conditions over time

    • It supports exploratory data analysis (unsupervised analysis) of time-course data

    • The package includes tools for statistical analysis of transcriptional responses under different biological conditions over time

  • Analysis workflow for SPAC977.06 expression data:

    a) Data preparation and quality control:

    • Normalize count data to account for technical variation

    • Assess batch effects and implement correction if necessary

    • Validate expression measurements using alternative methods (qPCR)

    b) Time-series specific analytical approaches:

    • Apply smoothing techniques to reduce noise while preserving trends

    • Implement autocorrelation analysis to capture temporal dependencies

    • Calculate rate-of-change metrics to identify critical time points

    • Apply clustering to identify genes with similar expression patterns

    c) Biological context integration:

    • Correlate expression changes with relevant cellular events

    • Compare with expression patterns of functionally related genes

    • Connect changes to upstream regulatory factors

  • Visualization approaches:

    • Generate heat maps showing expression changes over time

    • Create line plots with confidence intervals to visualize trends

    • Use principal component analysis to identify major sources of variation

The Fission dataset mentioned in the search results could serve as a reference for time-course analysis approaches in S. pombe .

How can researchers address reproducibility challenges in SPAC977.06 studies?

Ensuring reproducibility in SPAC977.06 research requires systematic approaches:

  • Experimental design considerations:

    • Implement proper randomization and blinding procedures

    • Calculate appropriate sample sizes based on expected effect sizes

    • Include all relevant controls in each experimental batch

    • Document all experimental conditions in detail (strain backgrounds, media compositions, growth parameters)

  • Data collection and analysis practices:

    • Establish clear criteria for data inclusion/exclusion before experiments begin

    • Use automation where possible to reduce operator variability

    • Implement pipeline approaches for consistent data processing

    • Maintain raw data alongside processed results

  • Validation approaches:

    • Verify key findings using orthogonal techniques

    • Replicate critical experiments in different laboratory settings

    • Test across multiple strain backgrounds to ensure generalizability

    • Consider sharing materials through repositories to enable independent validation

  • Reporting standards:

    • Document detailed methods following field-specific guidelines

    • Report all attempts, including unsuccessful experiments

    • Share analysis code and complete datasets

    • Distinguish between exploratory and confirmatory analyses

For experimental design specifically, researchers should follow established frameworks that include:

  • Defining clear variables and how they are related

  • Writing specific, testable hypotheses

  • Designing experimental treatments to manipulate independent variables

  • Carefully planning measurement of dependent variables

How should contradictory results in SPAC977.06 function be reconciled?

When faced with contradictory results regarding SPAC977.06 function, researchers should:

  • Methodological comparison:

    • Analyze differences in experimental approaches (in vivo vs. in vitro studies)

    • Compare protein expression systems and tags used

    • Evaluate strain backgrounds for potential modifying mutations

    • Assess sensitivity and specificity of detection methods

  • Contextual factors to consider:

    • Growth conditions may affect membrane protein function

    • Cell cycle stage might influence protein behavior

    • Stress or environmental factors could alter function

    • Post-translational modifications might vary between studies

  • Resolution strategies:

    • Design critical experiments that directly address contradictions

    • Perform detailed domain analysis to map functions to specific regions

    • Collaborate with groups reporting contradictory results

    • Develop mathematical models that might accommodate seemingly contradictory observations

  • Interpretation frameworks:

    • Consider if SPAC977.06 has multiple distinct functions

    • Evaluate if contradictions reflect different aspects of a complex phenotype

    • Assess if temporal dynamics explain divergent results

    • Determine if protein interaction partners differ between experimental systems

The systematic application of good experimental design principles can help resolve contradictions by ensuring that each study generates reliable, reproducible data that can be fairly compared.

What statistical approaches are recommended for analyzing SPAC977.06 interaction data?

Analysis of protein interaction data for SPAC977.06 requires specialized statistical approaches:

  • For immunoprecipitation-mass spectrometry (IP-MS) data:

    • Apply significance analysis methods to distinguish true interactions from background

    • Use contaminant repositories to filter common non-specific proteins

    • Implement label-free quantification followed by appropriate statistical testing

    • Consider Bayesian frameworks that incorporate prior knowledge of protein interactions

    Recent research with S. pombe transcription factors successfully used IP-MS to identify protein interactors, finding that over a quarter potentially form stable complexes . Similar approaches could be adapted for SPAC977.06.

  • For time-series gene expression data:

    • Apply methods that account for temporal autocorrelation

    • Consider functional data analysis for continuous temporal processes

    • Use dynamic Bayesian networks for inferring temporal dependencies

    • Implement latent variable models to capture underlying patterns

    The MultiRNAflow R package provides specialized tools for analyzing temporal RNA-seq data in S. pombe and could be applied to studies involving SPAC977.06 .

  • For network analysis of interaction data:

    • Calculate appropriate centrality measures to identify key interactions

    • Apply module detection algorithms to identify functional clusters

    • Implement permutation tests to assess network property significance

    • Use network visualization tools to communicate complex relationships

  • For validation and reproducibility:

    • Implement cross-validation to assess model stability

    • Calculate confidence intervals for interaction strengths

    • Apply bootstrapping to estimate parameter uncertainty

    • Consider independent validation datasets when available

These statistical approaches ensure robust interpretation of interaction data, helping to separate signal from noise in complex biological datasets while maintaining scientific rigor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.