Recombinant Schizosaccharomyces pombe UPF0494 membrane protein CPT2R1.01c (SPBCPT2R1.01c, SPBPB2B2.20c)

Shipped with Ice Packs
In Stock

Description

Protein Overview

  • Gene Names: SPBCPT2R1.01c (primary), SPBPB2B2.20c (alternative) .

  • UniProt ID: Q9HGQ1 .

  • Sequence: 280-amino-acid full-length protein with a predicted transmembrane domain .

  • Classification: Single-pass (bitopic) membrane protein, likely anchored via a Type II or IV topology based on sequence analysis .

Domain Architecture

FeatureDetails
Transmembrane RegionPredicted α-helical segment spanning residues ~200–220 (exact position uncharacterized) .
Soluble DomainsN-terminal cytoplasmic domain; C-terminal extracellular domain (hypothetical) .

Recombinant Protein Production

  • Expression System: Recombinant protein produced in E. coli or yeast systems .

  • Purification: Tris-based buffer with 50% glycerol for stability .

  • Storage: -20°C for long-term storage; working aliquots stable at 4°C for ≤1 week .

Key Physical Properties

ParameterValue
Molecular Weight~32 kDa (theoretical) .
Sequence CoverageFull-length (residues 1–280) .
Post-Translational ModificationsNone reported; lacks glycosylation motifs .

Genetic and Proteomic Context

  • Biological Role: Associated with membrane integrity and protein-protein interactions, though exact function remains uncharacterized .

  • Interactome:

    • BioGRID data identifies 25 interactors, including uncharacterized proteins and components of vesicle trafficking pathways .

    • No direct links to major pathways (e.g., cell cycle, DNA repair) in S. pombe .

Gene Ontology (GO) Annotations

GO TermAnnotation
Cellular ComponentIntegral component of membrane (GO:0016021) .
Biological ProcessNot yet annotated .
Molecular FunctionNot yet annotated .

Utility in Studies

  • Membrane Protein Dynamics: Serves as a model for studying single-pass transmembrane protein folding and localization .

  • Interaction Mapping: Used in pull-down assays to identify binding partners in S. pombe .

Knowledge Gaps

  • No in vivo functional studies or knockout phenotypes reported .

  • Structural data (e.g., X-ray crystallography, cryo-EM) are unavailable.

Handling Recommendations

  • Avoid repeated freeze-thaw cycles to prevent aggregation .

  • Validate protein integrity via SDS-PAGE before experimental use .

Context within S. pombe Biology

S. pombe is a premier model for studying conserved eukaryotic processes, including membrane trafficking and cell polarity . While UPF0494’s role remains elusive, its conservation across fungi suggests involvement in fundamental membrane-associated mechanisms. Future studies could leverage S. pombe’s genetic tractability to elucidate its function through knockout screens or synthetic genetic array (SGA) analyses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill them if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag.
Synonyms
SPBCPT2R1.01c; SPBPB2B2.20c; UPF0494 membrane protein CPT2R1.01c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBCPT2R1.01c
Target Protein Sequence
MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNT IKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTRSNFRWPLLIIWSIIIVFA VDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLMLLSLIFFAEFAVLALRVTGVII AVLGMIIAVLGMIIAALGATITGLLYFGHWALYKLVILSLGFKIVTPGDVCVSNTLPTHN GETALHSETTVGSDIEQIELQNMPTPVKK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0494 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

How does SPBCPT2R1.01c relate to other UPF0494 membrane proteins in S. pombe?

S. pombe contains multiple UPF0494 family members, including SPBCPT2R1.01c, SPBPB2B2.07c, and SPAC212.01c/CPT2R1.04c. Sequence alignment reveals structural similarities with significant homology in the transmembrane regions but distinct variations in the connecting loops . These proteins likely evolved through gene duplication events followed by functional diversification, as evidenced by their conserved core domains but divergent regulatory regions.

A comparison of key domains among S. pombe UPF0494 membrane proteins shows:

ProteinLengthNumber of predicted TM domainsUnique features
SPBCPT2R1.01c269 aa5-6Extended N-terminal domain
SPBPB2B2.07c250 aa5-6Distinct C-terminal sequence
SPAC212.01c280 aa6-7Longer connecting loops

This family of proteins appears to be specific to fungi and may represent adaptations to particular environmental conditions or cellular processes unique to fungal cells .

What computational approaches are recommended for predicting SPBCPT2R1.01c structure?

Multiple computational approaches should be employed for comprehensive structural prediction:

  • Transmembrane helix prediction algorithms (TMHMM, HMMTOP, Phobius) to identify membrane-spanning regions

  • Deep learning approaches like AlphaFold2, which has demonstrated remarkable accuracy in predicting membrane protein structures

  • Consensus methods like CCTOP or TOPCONS that combine multiple prediction algorithms

  • Hydropathy analysis using Kyte-Doolittle or Wimley-White scales

  • Evolutionary analysis through multiple sequence alignment of UPF0494 family members

The application of AlphaFold2 and similar deep learning tools has revolutionized membrane protein structural prediction as described in recent literature: "With the rise of deep learning-based methods, exploring the sequence space has become increasingly feasible, allowing the discovery of proteins with stable topologies and new functions" . For SPBCPT2R1.01c, these models can predict the arrangement of transmembrane helices and the topology of connecting loops with increasing confidence.

What are the optimal conditions for expressing and purifying SPBCPT2R1.01c?

Based on established protocols, the optimal expression and purification strategy involves:

  • Expression System: E. coli with an N-terminal His-tag for affinity purification

  • Culture Conditions: Growth at 30°C in LB medium with appropriate antibiotics and IPTG induction at OD600 of 0.6-0.8

  • Cell Lysis: Mechanical disruption in buffer containing detergents (DDM or CHAPS) to solubilize membrane proteins

  • Purification: Ni-NTA affinity chromatography with imidazole gradient elution

  • Storage: Either as lyophilized powder or in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Reconstitution: In deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol

  • Long-term Storage: Aliquoted samples at -20°C/-80°C to avoid repeated freeze-thaw cycles

Alternative expression systems include Schizosaccharomyces pombe itself, which offers advantages for eukaryotic protein expression: "Unlike E. coli, S. pombe provides for post-translational modifications of the proteins, which are often critical for the structure and function of eukaryotic proteins" . Using vectors with the nmt1 promoter allows for constitutive or induced expression of the membrane protein.

What strategies help overcome challenges in membrane protein solubilization and stabilization?

Membrane proteins like SPBCPT2R1.01c present unique challenges for solubilization and stabilization. Effective approaches include:

  • Detergent screening: Test multiple detergents including mild non-ionic (DDM, LMNG), zwitterionic (CHAPS, Fos-choline), and lipid-like (digitonin) detergents

  • Lipid supplementation: Addition of specific phospholipids can enhance stability

  • Buffer optimization: Systematic testing of different buffers, pH values, and salt concentrations

  • Stabilizing additives: Glycerol (10-20%), cholesterol hemisuccinate, or specific ligands

  • Alternative solubilization systems: Consider nanodiscs, amphipols, or styrene-maleic acid copolymer lipid particles (SMALPs)

Researchers should monitor protein stability using techniques like fluorescence-detection size-exclusion chromatography (FSEC), differential scanning fluorimetry, or limited proteolysis. Repeated freezing and thawing should be avoided, with working aliquots stored at 4°C for up to one week .

How can researchers validate the proper folding and functionality of recombinant SPBCPT2R1.01c?

Validation of proper folding requires multiple complementary approaches:

  • Biophysical characterization:

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm monodispersity

  • Structural integrity assessment:

    • Limited proteolysis to confirm compact folding

    • Negative-stain electron microscopy to visualize protein particles

    • Native PAGE to assess homogeneity

  • Cell-based validation:

    • Localization studies using fluorescently tagged variants

    • Functional complementation of knockout strains

    • Protein-protein interaction studies using techniques like FRET or split-GFP

The purity of recombinant SPBCPT2R1.01c can be guaranteed above 90% by SDS-PAGE detection , providing a baseline for quality control in structural and functional studies.

What experimental methods are most suitable for determining SPBCPT2R1.01c structure?

Multiple complementary techniques should be considered:

  • X-ray crystallography:

    • Requires crystallization of purified protein, often facilitated by:

    • Lipidic cubic phase (LCP) crystallization

    • Addition of antibody fragments to stabilize flexible regions

    • Systematic screening of detergents and crystallization conditions

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for high-resolution structure determination

    • Can be performed in detergent micelles, nanodiscs, or amphipols

    • May require antibody fragments for proteins <100 kDa

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Solution NMR for smaller domains

    • Solid-state NMR for membrane proteins in lipid environments

    • Requires isotopic labeling (13C, 15N, 2H)

As noted in recent literature: "The three main techniques that can be used to study membrane protein structure are X-ray Crystallography, Nuclear Magnetic Resonance (NMR) Spectroscopy, and Electron Microscopy" . The choice depends on protein size, stability, and the specific structural questions being addressed.

How can molecular dynamics simulations enhance our understanding of SPBCPT2R1.01c?

Molecular dynamics (MD) simulations offer powerful insights into membrane protein behavior:

  • Simulation setup:

    • CHARMM-GUI provides "the most comprehensive set of parameters for lipids required for modeling a variety of membranes"

    • Proper embedding in lipid bilayer using tools like OPM database for optimal orientation

    • Selection of appropriate force fields for membrane proteins

  • Analysis approaches:

    • Conformational dynamics and flexibility assessment

    • Lipid-protein interaction mapping

    • Water penetration and potential permeation pathways

    • Identification of stable vs. dynamic regions

  • Advanced simulation techniques:

    • Enhanced sampling methods to access longer timescales

    • Coarse-grained simulations for larger systems

    • Free energy calculations to assess energetics of conformational changes

MD simulations can reveal "structural analysis of the protein in lipid environment, linking structure to function, oligomeric state of membrane proteins, role of specific amino acids in the function, transport function through change of state, permeation, and selectivity mechanisms" .

What techniques are effective for studying SPBCPT2R1.01c membrane topology?

Determining the correct membrane topology of SPBCPT2R1.01c requires multiple approaches:

  • Computational predictions:

    • Transmembrane helix prediction algorithms (TMHMM, HMMTOP)

    • Hydropathy analysis using Kyte-Doolittle plots

    • Positive-inside rule validation

  • Experimental verification:

    • Protease protection assays to determine cytoplasmic vs. luminal domains

    • Site-specific labeling with membrane-impermeable reagents

    • Insertion of reporter tags (GFP, PhoA) at predicted loops

    • Cysteine scanning mutagenesis with accessibility assays

  • Structural approaches:

    • Cryo-EM with nanobody labeling of specific domains

    • EPR spectroscopy with site-directed spin labeling

    • Fluorescence quenching assays with lipid-embedded quenchers

Using these techniques in combination provides robust evidence for the membrane topology and orientation of the protein.

How can researchers investigate protein-protein interactions involving SPBCPT2R1.01c?

Investigating protein-protein interactions of membrane proteins requires specialized techniques:

  • Membrane yeast two-hybrid (MYTH) system:

    • "The membrane yeast two-hybrid (MTYH) technology allows for the identification of interactions between full-length integral membrane proteins"

    • S. pombe-specific arrayed libraries are available for high-throughput screening

    • The split-ubiquitin approach enables detection of interactions at the membrane

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Requires expression of tagged SPBCPT2R1.01c

    • Gentle solubilization with appropriate detergents

    • Quantitative approaches like SILAC can distinguish specific from non-specific interactions

  • Proximity labeling techniques:

    • BioID or APEX2 fusion proteins for in vivo proximity labeling

    • Identifies proteins in proximity to SPBCPT2R1.01c in living cells

    • Labeled proteins are captured and identified by mass spectrometry

  • Crosslinking mass spectrometry:

    • Chemical crosslinking of intact cells or purified complexes

    • Provides spatial constraints for interacting proteins

These techniques should be complemented with computational predictions and validated through reverse co-immunoprecipitation or functional assays.

What genetic approaches can elucidate the cellular function of SPBCPT2R1.01c?

Genetic manipulation in S. pombe provides powerful tools for functional characterization:

  • Gene deletion and modification:

    • CRISPR/Cas9 or homologous recombination for gene deletion

    • Tagged versions for localization and interaction studies

    • Point mutations to disrupt specific domains

  • Expression systems:

    • Conditional expression using the nmt1 promoter system

    • Regulated overexpression to assess gain-of-function effects

    • Complementation with mutant variants

  • Phenotypic characterization:

    • Growth assays under various conditions (temperature, pH, stress)

    • Microscopic analysis of cell morphology and division

    • Membrane integrity and dynamics studies

    • Vacuolar function tests (as membrane proteins may affect compartmentalization)

  • Genetic interaction mapping:

    • Synthetic genetic array analysis

    • Epistasis experiments to position SPBCPT2R1.01c within cellular pathways

    • Suppressor screens to identify functional partners

The S. pombe system is particularly valuable because "two vectors have been constructed for protein expression in S. pombe, pESP-1 and pESP-2. Both vectors use the nmt1 promoter for constitutive or induced expression of the gene of interest" .

What role might SPBCPT2R1.01c play in S. pombe cellular processes?

While the specific function remains uncharacterized, multiple lines of evidence suggest potential roles:

  • Membrane organization and integrity:

    • May contribute to membrane domain formation

    • Potential role in maintaining membrane fluidity or curvature

  • Transport functions:

    • Could facilitate transport of specific metabolites

    • May function as a channel for ions or small molecules

  • Vacuolar functions:

    • S. pombe V-ATPase mutants "lost the capacity for vacuolar acidification in vivo, and showed sensitivity to neutral pH or high concentrations of divalent cations including Ca2+"

    • SPBCPT2R1.01c might play related roles in vacuolar homeostasis

  • Stress response mechanisms:

    • Potential involvement in osmotic, oxidative, or pH stress responses

    • May function in adaptation to environmental changes

  • Cell wall biogenesis:

    • Possible coordination with cell wall synthesis machinery

    • May participate in trafficking of cell wall components

Deletion studies combined with phenotypic characterization would be necessary to determine the precise cellular role of this membrane protein.

What are the cutting-edge techniques for membrane protein crystallization applicable to SPBCPT2R1.01c?

Advanced crystallization strategies for challenging membrane proteins include:

  • Construct engineering:

    • Systematic truncation to remove flexible regions

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Surface entropy reduction through mutation of charged residues

    • Introduction of disulfide bonds to stabilize specific conformations

  • Crystallization methods:

    • Lipidic cubic phase (LCP) crystallization

    • Bicelle crystallization

    • Microseeding techniques

    • In situ crystallization with lipid-specific detergents

  • Antibody-mediated approaches:

    • Generation of conformation-specific nanobodies

    • Co-crystallization with antibody fragments

    • Use of crystallization chaperones like DARPins

Recent breakthroughs in computational design suggest additional possibilities: "Here we use a robust deep learning pipeline to design complex folds and soluble analogues of integral membrane proteins" . Creating soluble analogues while preserving key structural features could facilitate crystallization efforts.

How can researchers apply advanced biophysical techniques to study SPBCPT2R1.01c dynamics?

Cutting-edge biophysical approaches reveal crucial insights into membrane protein dynamics:

  • Single-molecule spectroscopy:

    • Single-molecule FRET to track conformational changes

    • Site-specific labeling to monitor domain movements

    • Detection of rare or transient conformational states

  • Advanced NMR approaches:

    • Methyl-TROSY NMR for large membrane proteins

    • Relaxation dispersion experiments for microsecond-millisecond dynamics

    • Solid-state NMR in native-like lipid environments

  • Hydrogen/deuterium exchange mass spectrometry (HDX-MS):

    • Identifies regions with different solvent accessibility

    • Maps dynamic regions onto structural models

    • Detects conformational changes induced by binding partners

  • Advanced computational methods:

    • Enhanced sampling molecular dynamics simulations

    • Markov state modeling to identify key conformational states

    • Machine learning approaches to predict dynamic behavior

These techniques provide unprecedented insights into the conformational landscape and dynamic behavior of membrane proteins like SPBCPT2R1.01c.

What systems biology approaches could position SPBCPT2R1.01c in broader cellular networks?

Integrative systems biology approaches offer comprehensive insights:

  • Multi-omics integration:

    • Transcriptomics to identify co-regulated genes

    • Proteomics to detect interaction partners and post-translational modifications

    • Lipidomics to assess effects on membrane composition

    • Metabolomics to identify potential transported substrates

  • Network analysis:

    • Construction of protein-protein interaction networks

    • Pathway enrichment analysis

    • Identification of functional modules containing SPBCPT2R1.01c

  • Comparative genomics:

    • Analysis across fungal species to identify conserved functions

    • Correlation with environmental adaptations

    • Identification of co-evolving gene clusters

  • Mathematical modeling:

    • Kinetic models of potential transport processes

    • Integration into whole-cell models of S. pombe

    • Prediction of system-level effects of SPBCPT2R1.01c perturbation

These approaches position SPBCPT2R1.01c within broader cellular networks and provide context for its specific functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.