Recombinant Schizosaccharomyces pombe UPF0494 membrane protein PB2B2.07c, also referred to as SPBPB2B2.07c, is a protein derived from the fission yeast Schizosaccharomyces pombe. Proteins in the UPF0494 family are conserved proteins of unknown function. Studies have shown that proteins within the UPF0494 family have several biochemical functions and interact directly with proteins and molecules .
Schizosaccharomyces pombe is a species of yeast used in the study of eukaryotic cells and is particularly useful for the examination of the cell cycle because it only has three chromosomes . The Schizosaccharomyces pombe genome has been fully sequenced, which facilitates the identification and study of its various proteins .
Recombinant Schizosaccharomyces pombe UPF0494 membrane proteins are available for research purposes. For example, Schizosaccharomyces pombe UPF0494 membrane protein C750.06c(SPAC750.06c) is available as a recombinant protein with the following characteristics :
Quantity: 50 µg
Source organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
UniProt Accession Number: Q9P3E5
Tag Information: Determined during the production process.
Storage Buffer: Tris-based buffer with 50% glycerol, optimized for the protein.
Storage Conditions: Store at -20℃; for extended storage, conserve at -20℃ or -80℃. Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Amino Acid Sequence: MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNT IKPQKDKMNIKTNKIKEFLNDPFTEFSKFHNSYYPDGRISTRSNFRWPLLIIWSIIIVFA VDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLmLLSLIFFAEFAVLALRVTGVII AVLGAVLGMIIAVLGMIIAALGMIIAALGATITGLLYFGHWALYKLVILSLGFKIVTPGD VCVSNTLPTHNGETALHSETTVGSDIEQIELQNMPTPVKK
Protein Names: UPF0494 membrane protein C750.06c
Gene Names: SPAC750.06c
Expression Region: 1-280 amino acids
Sequence Length: Full-length protein
Recombinant Full Length Schizosaccharomyces pombe UPF0494 membrane protein C1348.07(SPBC1348.07) Protein, His-Tagged also exists :
Recombinant Full Length Schizosaccharomyces pombe UPF0494 membrane protein C1348.07(SPBC1348.07) Protein (Q9P3V3) (1-230aa), fused to N-terminal His tag, was expressed in E. coli.
KEGG: spo:SPBPB2B2.07c
STRING: 4896.SPBPB2B2.07c.1
SPBPB2B2.07c is a membrane protein that appears to be associated with sterol-rich domains in the plasma membrane of S. pombe. These sterol-rich domains are enriched at the growing cell tips and at the site of cytokinesis, suggesting SPBPB2B2.07c may have spatial and temporal regulation throughout the cell cycle. Using a cytological approach, researchers can visualize the distribution of sterols and associated proteins in the membrane, which follows a cell-cycle-dependent pattern and requires a functional secretory pathway . Methodologically, filipin staining can be used to visualize sterol-rich domains, while fluorescently tagged SPBPB2B2.07c constructs allow for colocalization studies with these domains.
Research data indicates that SPBPB2B2.07c expression shows significant changes in aneuploid conditions. Expression ratio analysis demonstrates that in aneuploids containing chromosome 10 (Ch10), SPBPB2B2.07c has an expression ratio of 1.739 . This gene is categorized as "Swi6-bound," indicating its association with the heterochromatin protein Swi6, which is the S. pombe homolog of HP1 (Heterochromatin Protein 1). For experimental analysis, researchers typically use quantitative PCR and microarray approaches to measure expression levels across different genetic backgrounds, comparing normal haploid strains with aneuploid derivatives.
To generate recombinant SPBPB2B2.07c for in vitro studies, researchers should consider the following methodological approach:
Gene cloning: Amplify the SPBPB2B2.07c gene from S. pombe genomic DNA using PCR with specific primers that include appropriate restriction sites.
Vector construction: Clone the amplified gene into a suitable expression vector for either bacterial or yeast expression systems.
Expression optimization: For membrane proteins, specialized expression systems may be required, such as S. pombe itself or other eukaryotic systems that properly process membrane proteins.
Protein purification: Use detergent solubilization methods optimized for membrane proteins, followed by affinity chromatography.
Functional verification: Assess protein folding and activity using circular dichroism spectroscopy and functional assays specific to membrane proteins.
The challenges in producing recombinant membrane proteins necessitate careful optimization of solubilization conditions to maintain protein structure and function.
S. pombe provides an excellent model system for analyzing gene function through meiotic recombination studies. For SPBPB2B2.07c specifically:
Strain construction: Generate strains carrying mutations or tagged versions of SPBPB2B2.07c.
Meiotic induction: Culture cells in nitrogen-depleted medium to induce meiosis.
Analysis methods: Both random spore analysis and tetrad analysis can be employed .
Random spore analysis allows examination of large numbers of meiotic products (~10^8 spores).
Tetrad analysis permits the study of all four products from individual meioses.
When analyzing SPBPB2B2.07c's role in meiosis, researchers should track both intragenic recombination (gene conversion) and intergenic recombination (crossing-over), as well as spore viability . This comprehensive approach can reveal whether SPBPB2B2.07c affects specific aspects of meiotic chromosome dynamics or recombination.
Based on experimental data, SPBPB2B2.07c is classified as "Swi6-bound" in normal haploid cells, but shows decreased Swi6 binding in aneuploid conditions . To investigate this relationship, researchers can employ:
Chromatin immunoprecipitation (ChIP): To directly measure Swi6 binding to the SPBPB2B2.07c genomic region.
Fluorescence microscopy: Using tagged versions of both proteins to visualize potential colocalization.
Genetic interaction studies: Creating double mutants with swi6 and SPBPB2B2.07c mutations to assess phenotypic consequences.
Protein-protein interaction assays: Such as co-immunoprecipitation or yeast two-hybrid analysis to determine if the interaction is direct or indirect.
A comprehensive experimental design should include appropriate controls and multiple methodological approaches to cross-validate findings.
Sterol-rich membrane domains in S. pombe can be manipulated using:
Sterol sequestering agents: Compounds like filipin or nystatin that bind to membrane sterols and disrupt domain integrity.
Genetic approaches: Mutations in sterol biosynthesis genes that alter membrane composition.
Research shows that disruption of sterol-rich domains affects multiple processes including cytokinesis . For SPBPB2B2.07c specifically, researchers should monitor:
Protein stability and localization after domain disruption
Effects on cell growth, polarity, and division
Interactions with cytoskeletal components, particularly the actomyosin ring
The integrity of sterol-rich domains appears crucial for the proper maintenance of the actomyosin ring and its attachment to the plasma membrane , suggesting that SPBPB2B2.07c may function at this critical interface.
While SPBPB2B2.07c is primarily classified as a "Swi6-bound" gene, data suggests it may also respond to environmental stressors. To systematically study stress responses:
Design experiments exposing S. pombe cultures to various stresses (oxidative, temperature, osmotic, etc.)
Use RNA-seq or qPCR to measure expression changes
Compare with known stress-responsive genes
The following data table shows selected gene expression ratios in relation to stress and Swi6 binding:
| Gene ID | Expression Ratio | Classification | Swi6 Binding Change |
|---|---|---|---|
| SPBPB2B2.07c | 1.739 | Swi6-bound | Swi6-decreased |
| SPBPB2B2.09c | 3.504 | Swi6-bound | Swi6-decreased |
| SPBPB2B2.06c | 3.252 | Swi6-bound | Swi6-decreased |
| SPBC1348.03 | 2.876 | Swi6-bound | n.d. |
| SPBC1348.12 | 1.204 | Up-stress | - |
| SPAC328.03 | 1.291 | Up-stress | 0.797 |
This data indicates a complex relationship between Swi6 binding, stress response, and gene expression regulation .
When faced with contradictory data about SPBPB2B2.07c function, researchers should implement a systematic approach:
Critical literature review: Identify specific contradictions and potential methodological differences.
Replicate key experiments: Using standardized protocols across different conditions.
Employ orthogonal methods: Verify findings using fundamentally different experimental approaches.
Consider genetic background effects: Test hypotheses in multiple strain backgrounds.
Collaborate with other laboratories: Independent verification of controversial findings.
As noted in research on experimental design for complex biological systems, "resolving the contradictions and maintaining consistency" requires both "limited mathematical modeling" and "thorough literature research and logical argumentation" . This approach is particularly important for membrane proteins like SPBPB2B2.07c, where experimental conditions can significantly impact results.
To predict potential interaction partners of SPBPB2B2.07c, researchers can employ multiple bioinformatic strategies:
Sequence-based approaches:
Identify conserved protein-protein interaction motifs
Analyze coevolution patterns across yeast species
Search for shared regulatory elements in promoter regions
Structure-based methods:
Predict membrane topology and potential interaction interfaces
Model protein structure using homology-based approaches
Perform molecular docking simulations with candidate partners
Network analysis:
Examine gene co-expression networks across multiple conditions
Analyze genetic interaction data from systematic studies
Integrate proteomic data from membrane fraction analyses
Data integration:
Combine multiple prediction algorithms using ensemble methods
Cross-reference with experimental data from related membrane proteins
Apply Bayesian approaches to weight various sources of evidence
When implementing these approaches, researchers should maintain rigorous validation standards, as computational predictions require experimental verification.
Comprehensive metadata collection is crucial for reproducible research on SPBPB2B2.07c. Researchers should document:
Strain information: Complete genotype, source, and verification methods
Growth conditions: Media composition, temperature, growth phase at harvest
Experimental parameters: All buffer compositions, incubation times, and equipment settings
Data processing: All transformation steps, normalization methods, and statistical approaches
As noted in experimental design literature, "metadata on experiments is very important" for ensuring reproducibility and facilitating data integration across studies . For membrane proteins like SPBPB2B2.07c, additional metadata should include membrane fraction preparation methods, detergent types and concentrations, and protein stability verification approaches.
Designing decisive experiments requires careful consideration of:
Hypothesis formulation: Develop clear, testable hypotheses based on current knowledge
Controls: Include appropriate positive and negative controls
Orthogonal approaches: Combine genetic, biochemical, and imaging methods
Quantitative measurements: Ensure statistical power through proper replication
Validation strategies: Plan secondary experiments to confirm initial findings
When working with membrane proteins in S. pombe, decisive experiments often involve:
Creating conditional alleles to study essential functions
Using fluorescent protein fusions with appropriate controls for localization
Employing rapid induction/repression systems to study acute effects
Combining in vivo and in vitro approaches to validate findings
The experimental design should aim to "underpin as much as possible" any hypotheses generated about SPBPB2B2.07c function .
Research on SPBPB2B2.07c has potential to advance understanding of:
Membrane domain organization: As a component of sterol-rich domains, SPBPB2B2.07c can serve as a model for how proteins are selectively incorporated into or excluded from specific membrane regions .
Chromatin-membrane interactions: The dual association with Swi6 (heterochromatin) and membrane domains suggests potential novel mechanisms for nuclear-cytoplasmic communication .
Cell cycle regulation: The cell-cycle-dependent distribution of sterol-rich domains indicates SPBPB2B2.07c may participate in coordinating membrane dynamics with cell cycle progression .
Evolutionary conservation: Comparative studies across fungi could reveal conserved principles of membrane organization and function.
By establishing S. pombe as "a genetically tractable model organism in which to study the role(s) of sterol-rich membrane domains in cell polarity and cytokinesis" , researchers can use SPBPB2B2.07c as an entry point to understand broader principles of membrane biology.
Emerging technologies with potential to advance SPBPB2B2.07c research include:
Cryo-electron microscopy: For high-resolution structural analysis of membrane proteins in near-native environments
Super-resolution microscopy: To visualize nanoscale organization of membrane domains
Proximity labeling techniques: Such as BioID or APEX to identify neighboring proteins in intact cells
Single-cell genomics and proteomics: To capture cell-to-cell variation in SPBPB2B2.07c expression and function
Genome editing tools: CRISPR-Cas9 systems optimized for S. pombe to create precise mutations
These technologies could help resolve current research challenges, particularly regarding the integration of SPBPB2B2.07c into both heterochromatin regulation and membrane domain organization—two cellular processes traditionally studied separately.