Recombinant Schizosaccharomyces pombe UPF0494 membrane protein PB2B2.14c (SPBPB2B2.14c) is a protein expressed in the fission yeast Schizosaccharomyces pombe . It is categorized as a transmembrane protein and contains a UPF0494 domain of unknown function .
The protein sequence for Recombinant Schizosaccharomyces pombe UPF0494 membrane protein PB2B2.14c (SPBPB2B2.14c) is :
MVRDTRNVDLEWGLELCKPEKVNKQNLFTNIIKPQKDKINIKTDKIKFFLDNLFTEFSKFHDSCYPDGRISTRSKLRWPLLIIWCILIVFAIDKNFEVKDFLSIWINESFINENRFYSEIWGPIAIYICLFVLLLLGLIYCSKIVVKAIPLISIVIAAVVVIIAVAMVKILYICHWLIYKILILAFGIKVKPLGDTLPTHNGETGSHSKATVGSDIEQIEFQNMPTPVKK
While the specific function of the UPF0494 membrane protein PB2B2.14c is not explicitly detailed, Schizosaccharomyces pombe is a well-studied organism used in various research areas. Some key aspects of research involving Schizosaccharomyces pombe include:
Sterol-rich membrane domains: Sterols in Schizosaccharomyces pombe are enriched in the plasma membrane at growing cell tips and sites of cytokinesis .
Heme Assimilation: The Schizosaccharomyces pombe shu1+ gene encodes a cell-surface protein required for assimilating exogenous heme .
RanBP1 Function: Studies on Ran-binding protein-1 (RanBP1) in Schizosaccharomyces pombe suggest that only the Ran-binding domain (RBD) of sbp1p is required for its function in fission yeast, and this function may not require confinement of the RBD to the cytosol .
KEGG: spo:SPBPB2B2.14c
STRING: 4896.SPBPB2B2.14c.1
SPBPB2B2.14c is a gene in Schizosaccharomyces pombe that encodes a UPF0494 family membrane protein. While the specific function remains to be fully characterized, genomic studies indicate that it is located at the right end of chromosome 2 (2-R) and is among the genes bound by the heterochromatin protein Swi6, suggesting potential involvement in chromatin organization or transcriptional regulation . The UPF0494 family is a group of uncharacterized membrane proteins with conserved structure but undetermined function across species.
As a membrane protein, SPBPB2B2.14c likely contributes to cellular membrane organization, potentially in specialized membrane domains. Research in S. pombe has established that membrane proteins, particularly those in sterol-rich domains, play crucial roles in cell polarity and cytokinesis . Experimental approaches to determine its specific function might include gene deletion studies, localization studies using fluorescent protein tagging, and interaction studies to identify binding partners.
SPBPB2B2.14c expression appears to be regulated in a cell-cycle dependent manner, similar to other membrane proteins in S. pombe. Cell-cycle regulation often involves periodic expression patterns coordinated with specific cell cycle events. To study this regulation experimentally, researchers should:
Synchronize S. pombe cultures using methods such as nitrogen starvation-induced G1 arrest followed by release, or hydroxyurea-induced S-phase arrest.
Collect samples at defined time points through the cell cycle.
Analyze SPBPB2B2.14c mRNA levels using quantitative RT-PCR and protein levels using western blotting with specific antibodies.
Correlate expression patterns with cell cycle phases identified by microscopy or flow cytometry.
Data from gene expression studies in aneuploid strains shows that SPBPB2B2.14c has a 1.520-fold expression increase in aneuploids containing chromosome 10 compared to normal haploid strains . This suggests its expression is sensitive to genomic imbalances, which may have implications for its regulation in normal cell cycle progression.
While specific localization data for SPBPB2B2.14c is not directly provided in the available research, as a membrane protein, it likely localizes to specific domains within the plasma membrane. By analogy with other membrane proteins in S. pombe, it may be enriched at particular cellular locations such as growing cell tips or the division site.
To determine the subcellular localization of SPBPB2B2.14c, researchers should:
Generate a strain expressing SPBPB2B2.14c tagged with a fluorescent protein (e.g., GFP or mCherry) at either the N- or C-terminus, ensuring the tag doesn't interfere with membrane insertion.
Visualize the tagged protein using fluorescence microscopy throughout the cell cycle.
Perform co-localization experiments with known markers of cellular compartments, particularly plasma membrane domains.
Consider using techniques like FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics and membrane mobility.
Research on sterol-rich membrane domains in S. pombe has shown that these domains are enriched at growing cell tips and the site of cytokinesis . If SPBPB2B2.14c associates with these domains, it would be expected to display a similar localization pattern.
As a UPF0494 family membrane protein, SPBPB2B2.14c likely contains multiple transmembrane domains that anchor it within the cellular membrane. While specific structural data for this protein is limited, computational analysis and comparative studies with related proteins can provide insights into its structure.
Methodological approaches to characterize the protein structure include:
Bioinformatic analysis using tools like TMHMM, SignalP, and TOPCONS to predict transmembrane domains, signal peptides, and topology.
Hydropathy plot analysis to identify hydrophobic regions likely to span the membrane.
Structural prediction using modern AI-based tools like AlphaFold2 or RoseTTAFold.
Experimental validation of topology using techniques such as protease protection assays or reporter fusion constructs.
For detailed structural studies, researchers would need to express and purify the recombinant protein, potentially using heterologous expression systems optimized for membrane proteins, followed by structural determination methods such as X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.
Swi6 is the S. pombe homolog of mammalian Heterochromatin Protein 1 (HP1) and plays a crucial role in heterochromatin formation and gene silencing. According to the gene expression data, SPBPB2B2.14c is classified as "Swi6-bound" with an expression ratio of 1.852 , indicating significant association with this heterochromatin protein.
To investigate how Swi6 binding affects SPBPB2B2.14c:
Perform Chromatin Immunoprecipitation (ChIP) assays following the protocol described in the research: fix cells with formaldehyde, isolate chromatin, and immunoprecipitate with anti-Swi6 antibodies to quantify Swi6 binding to the SPBPB2B2.14c locus .
Compare SPBPB2B2.14c expression levels in wild-type and swi6Δ deletion strains using RT-qPCR and western blotting.
Analyze the chromatin state at the SPBPB2B2.14c locus using ChIP with antibodies against histone modifications characteristic of heterochromatin (e.g., H3K9me).
Perform reporter gene assays by replacing the SPBPB2B2.14c coding sequence with a reporter gene to assess how Swi6 binding affects transcription from this locus.
The research data indicates that in aneuploid strains containing chromosome 10, SPBPB2B2.14c is among the genes whose binding to Swi6 is decreased compared to normal haploid strains . This suggests that genomic imbalances can affect the heterochromatin status of this gene, potentially altering its expression and function in these conditions.
Investigating SPBPB2B2.14c's role in membrane organization requires a multi-faceted approach that combines genetic, biochemical, and microscopy techniques:
Generate and characterize deletion mutants (spbpb2b2.14cΔ) to assess phenotypic consequences, particularly focusing on membrane-related processes such as cell polarity, division, and response to membrane stress.
Examine the integrity of sterol-rich membrane domains in wild-type versus mutant cells using filipin staining, which specifically labels sterols in the plasma membrane .
Perform lipidomic analysis to determine if SPBPB2B2.14c affects membrane lipid composition, particularly sterols and sphingolipids that are enriched in specialized membrane domains.
Use super-resolution microscopy techniques (such as PALM or STORM) with appropriately tagged proteins to visualize nanoscale membrane organization.
Employ techniques to manipulate membrane domains integrity, such as sterol sequestering agents (like filipin or methyl-β-cyclodextrin) or genetic manipulations of sterol biosynthesis, and observe effects on SPBPB2B2.14c localization and function .
Research in S. pombe has established that sterol-rich membrane domains are important for multiple processes regulating cytokinesis, and disruption of these domains can lead to defects in actomyosin ring maintenance and attachment to the plasma membrane . Determining whether SPBPB2B2.14c contributes to these processes would provide valuable insights into its cellular function.
The expression data available for SPBPB2B2.14c in aneuploid strains provides interesting insights into how genomic imbalances affect this gene. In the aneuploid strain containing chromosome 10 (Ch10), SPBPB2B2.14c shows a 1.520-fold increase in expression relative to the normal haploid strain . This moderate upregulation suggests that the gene responds to aneuploidy-induced cellular stress or changes in chromosome organization.
To further investigate this phenomenon:
Perform comprehensive gene expression analysis across multiple aneuploid strains with different chromosome imbalances to determine if SPBPB2B2.14c regulation is specific to Ch10 aneuploidy or a general response to genomic imbalance.
Use ChIP-seq to map genome-wide changes in Swi6 binding patterns in aneuploid versus haploid strains, focusing on SPBPB2B2.14c and related genes.
Investigate potential regulatory mechanisms by analyzing the promoter region of SPBPB2B2.14c for binding sites of stress-responsive transcription factors.
Perform cellular phenotyping to correlate changes in SPBPB2B2.14c expression with specific cellular defects in the aneuploid strains.
The data shows that SPBPB2B2.14c is among a group of Swi6-bound genes whose expression increases in aneuploid strains while simultaneously showing decreased Swi6 binding . This apparent contradiction - increased expression despite being normally repressed by Swi6 - suggests complex regulatory mechanisms that warrant further investigation.
Purifying membrane proteins like SPBPB2B2.14c for structural studies presents significant technical challenges due to their hydrophobic nature and requirement for a lipid environment. A comprehensive strategy includes:
Expression system selection:
Bacterial systems (E. coli): Use specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression.
Yeast systems: Consider Pichia pastoris or S. cerevisiae, which may provide a more native-like environment for S. pombe proteins.
Insect cell systems: Baculovirus-infected insect cells often yield higher quantities of properly folded eukaryotic membrane proteins.
Fusion tag optimization:
Use affinity tags such as His6, FLAG, or Strep-tag for initial purification.
Consider fusion partners that enhance solubility and expression (e.g., MBP, SUMO, or GFP).
Place tags carefully to avoid disrupting membrane insertion or protein function.
Membrane extraction and solubilization:
Screen detergents systematically, starting with mild non-ionic detergents (DDM, LMNG, OG).
Consider alternative solubilization strategies like nanodiscs, amphipols, or SMALPs (styrene-maleic acid lipid particles).
Optimize detergent:protein ratios and solubilization conditions (temperature, time, buffer components).
Purification workflow:
Initial capture using affinity chromatography.
Further purification using size exclusion chromatography to remove aggregates and ensure monodispersity.
Consider ion exchange chromatography as an additional purification step if needed.
Quality assessment:
Evaluate protein purity by SDS-PAGE and Western blotting.
Assess protein homogeneity by dynamic light scattering and analytical ultracentrifugation.
Verify protein folding using circular dichroism spectroscopy.
For structural studies specifically, researchers should optimize buffer conditions to maintain protein stability while being compatible with the chosen structural determination method (X-ray crystallography, cryo-EM, or NMR).
Sterol-rich membrane domains (also known as lipid rafts) in S. pombe are enriched at growing cell tips and the site of cytokinesis, and they play crucial roles in cell polarity and division . As a membrane protein, SPBPB2B2.14c may associate with these domains in several possible ways:
Direct interaction with sterols: Some membrane proteins contain sterol-binding motifs (e.g., CRAC or CARC motifs) that mediate preferential localization to sterol-rich domains. Computational analysis of the SPBPB2B2.14c sequence could identify potential sterol-binding motifs.
Preferential partitioning: The transmembrane domains of SPBPB2B2.14c may have physicochemical properties that favor association with ordered lipid domains. This can be investigated using:
Detergent resistance assays, where sterol-rich domains resist solubilization by certain detergents at cold temperatures.
Liposome flotation assays with reconstituted membrane domains of varying lipid compositions.
FRET-based approaches to detect nanoscale proximity to known raft markers.
Protein-protein interactions: SPBPB2B2.14c might associate with sterol-rich domains indirectly through interactions with other proteins already enriched in these domains. Co-immunoprecipitation, proximity labeling techniques (BioID, APEX), or yeast two-hybrid screens could identify potential interaction partners.
Post-translational modifications: Modifications like palmitoylation can target proteins to sterol-rich domains. Mass spectrometry analysis of purified SPBPB2B2.14c could identify such modifications.
Research has shown that disrupting sterol-rich domains in S. pombe using sterol-sequestering agents or genetic approaches leads to defects in actomyosin ring maintenance and attachment to the plasma membrane during cytokinesis . If SPBPB2B2.14c functions within these domains, similar phenotypes might be observed in spbpb2b2.14cΔ mutants.
Detecting low-abundance membrane proteins like SPBPB2B2.14c can be challenging in experimental settings. Several methodological approaches can enhance detection sensitivity:
Optimize extraction methods:
Use specialized membrane protein extraction buffers containing appropriate detergents.
Consider sequential extraction procedures to enrich for membrane fractions.
Implement subcellular fractionation to concentrate membrane proteins before analysis.
Enhance antibody-based detection:
Develop high-affinity antibodies specifically against SPBPB2B2.14c or use epitope tagging.
Employ signal amplification techniques such as tyramide signal amplification or poly-HRP detection systems.
Use proximity ligation assays (PLA) which can detect proteins with greater sensitivity than conventional immunofluorescence.
Implement protein enrichment strategies:
Use affinity purification with antibodies or epitope tags to concentrate the protein.
Consider overexpression systems, being mindful that overexpression may alter localization or function.
Utilize methods to stabilize the protein and prevent degradation during extraction.
Employ advanced detection technologies:
Consider mass spectrometry-based approaches, particularly targeted methods like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM).
Use fluorescent protein fusions and highly sensitive imaging techniques such as spinning disk confocal microscopy or light sheet microscopy.
Apply super-resolution microscopy techniques that can detect single molecules.
These methodologies should be carefully validated to ensure they detect authentic SPBPB2B2.14c without artifacts or false positives.
When confronting contradictory phenotypic data in SPBPB2B2.14c research, a systematic approach to resolving these discrepancies is essential:
Validate genetic manipulations:
Confirm gene deletion or modification by sequencing.
Check for potential second-site mutations using whole-genome sequencing.
Use complementation tests to verify phenotype rescue with wild-type gene reintroduction.
Consider creating new deletion strains using alternative methods to rule out construct-specific effects.
Control for strain background effects:
Test the phenotype in multiple S. pombe strain backgrounds.
Create and analyze the mutation in freshly derived strains to minimize adaptation.
Consider the influence of epigenetic factors or cellular states on phenotype manifestation.
Standardize experimental conditions:
Carefully control growth conditions, including media composition, temperature, and cell density.
Establish standardized protocols for phenotypic assays, including specific time points and measurement methods.
Blind the analysis when possible to reduce experimenter bias.
Employ quantitative approaches:
Use automated, high-throughput phenotyping methods when available.
Perform quantitative analysis with appropriate statistical methods rather than relying on qualitative assessments.
Consider population heterogeneity through single-cell analysis methods.
Address context dependency:
Investigate whether phenotypes are condition-dependent (stress, cell cycle phase, growth conditions).
Consider synthetic interactions with other genes that might explain contradictory observations.
Evaluate potential compensatory mechanisms that might mask phenotypes in certain conditions.
By systematically addressing these aspects, researchers can identify the source of contradictions and develop a more nuanced understanding of SPBPB2B2.14c function.