Recombinant Schizosaccharomyces pombe UPF0588 membrane protein C20F10.02c (SPBC20F10.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SPBC20F10.02c; UPF0588 membrane protein C20F10.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC20F10.02c
Target Protein Sequence
MHRAAAVDTTPKIVFYYKCLLNKNWNEPINNIFWGEFFLLQPRLEVLSQLLRECPKQELT VNGPKFHSMYLYISEILKSKAESLRIRNSLATLQTFLAELSVRKPTDVNFTIFLLLGNID SIDIQFSAFIKNLCQLVKDSEDVQSVEISLRFVLHFVSFLYNSSFISHIYGNYDVFSTLY TVILKRKFGFETAVYAIGLLSACDKFETVNTFRLGLSKIVDEEFFSSVLSSSAQQLISLR DFYVSIKPDNPLTGSFFNLFSLRSSSNNPDSDQESQFSRLPDERATMFFTIYELCCCNKL FLKKLVEGGEKNGEAPLEALLSLLSYINTHQRQSERSHHFSILSLILFHIIIDDRSLLYR LTDKKFKISVRVCSQRYPYPPNATKPATPLGYMLDICCIGIQHNMKLNLSATMYFLYFSF VYRAMTSLVQDGIRMEYHWLELWRVLFSFLDFVSVLINTSPTEDVTRLLELILDVLAYII SNGDALVIRSDELVDLFYKLLHSSKNFSSFSSKIPDERLGALNYLLEVTEYLTSKTVDLP RSTADEVESVIKLELESIPVAKQNAFGGVPPFKESQYRLFHKRASRGMADLLRRKSEAAN
Uniprot No.

Target Background

Database Links
Protein Families
UPF0588 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SPBC20F10.02c and what is its function in S. pombe?

SPBC20F10.02c is classified as a DUF1741 family protein (Domain of Unknown Function) in Schizosaccharomyces pombe (fission yeast) . It is also known as a UPF0588 membrane protein, suggesting its localization to cellular membranes . The protein consists of 600 amino acids and contains membrane-spanning regions, indicating it functions within cellular membranes .

While the exact biological function remains under investigation, its classification in the UPF0588 family suggests it may have roles in membrane organization, transport, or signaling pathways. The protein is encoded by a protein-coding gene (Entrez Gene ID: 2540697) and generates a protein product identified by UniProt ID O42972 .

How evolutionarily conserved is SPBC20F10.02c across species?

SPBC20F10.02c has homologs across multiple eukaryotic species, indicating evolutionary conservation of this protein family. Homologs have been identified in:

OrganismGene/Protein IdentifierProtein Accession
Homo sapiens (human)C10orf76NP_078817.2
Mus musculus (mouse)9130011E15RikNP_938038.2
Rattus norvegicus (rat)RGD1564887XP_574677.2
Danio rerio (zebrafish)zgc:63733NP_956913.2
Drosophila melanogaster (fruit fly)CG8379NP_996185.1
Neurospora crassaNCU08708XP_963569.2
Magnaporthe oryzae (rice blast fungus)MGG_14714XP_003718906.1

This conservation across species from fungi to mammals suggests that this protein family likely serves an important cellular function, despite its current classification as a domain of unknown function.

What expression systems are optimal for producing recombinant SPBC20F10.02c?

Based on available data, E. coli has been successfully used as an expression system for producing recombinant SPBC20F10.02c, with the protein fused to an N-terminal His-tag . The full-length protein (amino acids 1-600) can be expressed in this system.

For optimal expression, researchers should consider:

  • Expression vector selection: Vectors with strong promoters suitable for membrane protein expression

  • E. coli strain optimization: BL21(DE3), C41(DE3), or C43(DE3) strains which are often used for membrane protein expression

  • Induction conditions: Typically lower temperatures (16-25°C) with reduced IPTG concentrations to minimize aggregation

  • Detergent screening: For membrane protein solubilization during purification

Other potential expression systems that might be explored include yeast expression systems (particularly S. cerevisiae or native S. pombe) for more authentic post-translational modifications.

What are effective purification and storage protocols for recombinant SPBC20F10.02c?

The successful purification and storage of recombinant SPBC20F10.02c involves several critical steps:

Purification Protocol:

  • Affinity chromatography using the N-terminal His-tag with Ni-NTA resin

  • Buffer optimization containing appropriate detergents for membrane protein stability

  • Potential secondary purification steps (size exclusion, ion exchange chromatography)

Storage Recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquot to avoid repeated freeze-thaw cycles (not recommended)

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is provided as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Reconstitution Protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to 5-50% final concentration (recommended 50%)

  • Aliquot for long-term storage at -20°C/-80°C

How can I design knockout experiments to characterize SPBC20F10.02c function?

Designing effective knockout experiments for SPBC20F10.02c requires careful consideration of multiple factors:

CRISPR/Cas9 Approach:
Based on source , CRISPR/Cas9 genome editing has been successfully applied for generating deletion mutants in S. pombe genes, including SPNCRNA.2470Δ and SPAC688.13Δ. A similar approach can be applied to SPBC20F10.02c:

  • gRNA design: Select target sequences specific to SPBC20F10.02c with minimal off-target effects

  • Donor DNA design: Include homology arms flanking the targeted region

  • Transformation protocol: Optimize for S. pombe using standard lithium acetate method

  • Screening strategy: Develop PCR-based screening to identify successful deletions

Phenotypic Assays:
When characterizing the knockout mutant, consider these experimental approaches:

  • Growth analysis under various conditions (temperature, stress, carbon sources)

  • Spore formation and germination efficiency assessment

  • Membrane integrity assays

  • Comparative transcriptomics/proteomics between wild-type and knockout strains

Controls:
Include appropriate controls in all experiments:

  • Wild-type S. pombe strains (same genetic background)

  • Complementation with the wild-type gene to verify phenotype rescue

  • Additional controls specific to each phenotypic assay

How do I integrate transcriptomic and proteomic approaches when studying SPBC20F10.02c?

Integrating multi-omics data requires sophisticated analytical approaches to address the frequently observed discrepancies between transcript and protein levels:

Data Collection Strategy:

  • Sample preparation: Extract RNA and protein from the same biological samples to minimize variation

  • Experimental design: Include biological replicates (n≥3) for statistical robustness

  • Normalization method selection: Apply appropriate normalization for each data type

Integration Approach:
Based on information from source , researchers observed weak negative correlation between transcriptomic and proteomic changes in S. pombe spores. This highlights the importance of:

  • Correlation analysis: Calculate Pearson or Spearman correlation between transcript and protein fold changes

  • Visualization: Create scatterplots to illustrate relationships between transcriptomic and proteomic data

  • Pathway analysis: Analyze enriched pathways at both levels to identify biological processes

Handling Discrepancies:
When faced with discrepancies between transcript and protein levels (as noted in ):

  • Consider post-transcriptional regulation mechanisms

  • Investigate protein stability and degradation pathways

  • Examine translation efficiency differences

  • Validate findings with targeted approaches (qPCR, Western blotting)

What methodologies are effective for studying SPBC20F10.02c during stress conditions?

Research on S. pombe genes during stress conditions requires specific methodological considerations:

Stress Exposure Protocols:

  • Heat shock: Based on source , heat shock protocols have been applied to study S. pombe spores

  • Oxidative stress: Using H₂O₂ or paraquat at standardized concentrations

  • Osmotic stress: Applying NaCl or sorbitol at varying concentrations

  • Nutritional limitation: Restricting nitrogen or carbon sources

Analytical Approaches:

  • PCA analysis: Principal Component Analysis can reveal stress-dependent differences in gene expression or protein abundance

  • Differential expression analysis: Compare stressed vs. non-stressed conditions

  • Time-course experiments: Monitor changes over time after stress application

Important Controls:

  • Unstressed controls maintained under optimal growth conditions

  • Time-matched sampling to account for growth phase effects

  • Analysis of known stress-responsive genes as positive controls

How can Weighted Correlation Network Analysis (WGCNA) be applied to understand SPBC20F10.02c function?

WGCNA is a powerful systems biology method for understanding gene function through co-expression network analysis. Based on source , which describes WGCNA application to S. pombe data:

Implementation Protocol:

  • Data acquisition: Collect gene expression data across multiple conditions

  • Batch effect removal: Apply appropriate statistical methods to remove technical variation

  • Network construction: Build co-expression network using correlation and topological overlap measure

  • Module identification: Cluster genes into modules of co-expressed genes

  • Module-trait correlation: Correlate modules with biological traits of interest

Identification of Hub Genes:

  • Define connectivity measures within modules

  • Identify highly connected genes as potential hub genes

  • Select candidate hub genes for further functional analysis

For SPBC20F10.02c analysis, this approach could reveal:

  • Co-expression partners suggesting functional pathways

  • Regulatory relationships with other genes

  • Potential involvement in specific biological processes

What are common challenges in purifying and stabilizing recombinant SPBC20F10.02c?

As a membrane protein, SPBC20F10.02c presents several purification challenges:

Solubilization Challenges:

  • Detergent selection: Membrane proteins require optimal detergents for extraction from membranes

  • Protein aggregation: Tendency to form aggregates during expression and purification

  • Maintaining native conformation: Ensuring proper folding in the absence of lipid bilayers

Recommended Solutions:

  • Detergent screening: Test multiple detergents (DDM, LMNG, CHAPS) for optimal solubilization

  • Buffer optimization: Include stabilizing agents like glycerol (5-50%) and trehalose (6% as used in commercial preparations)

  • Temperature control: Maintain lower temperatures during purification to minimize aggregation

  • Addition of lipids: Consider adding specific lipids to maintain native-like environment

Storage Stability:
From source , the following stability recommendations apply:

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, maintain at -20°C/-80°C with 50% glycerol

How can I optimize experimental design for studying membrane protein interactions?

Studying membrane protein interactions requires specialized approaches:

Methods Selection:

  • Co-immunoprecipitation adaptations: Use mild detergents to preserve protein-protein interactions

  • Crosslinking approaches: Apply membrane-permeable crosslinkers before solubilization

  • Proximity labeling: BioID or APEX2 fusion proteins to identify proximal interacting partners

  • Split-reporter assays: Modified membrane yeast two-hybrid systems

Experimental Design Considerations:

  • Control selection: Include appropriate negative controls (unrelated membrane proteins)

  • Expression level monitoring: Verify comparable expression levels between bait and prey proteins

  • Localization confirmation: Verify proper membrane localization of fusion proteins before interaction studies

  • Validation strategy: Use multiple complementary methods to confirm interactions

What are best practices for phenotypic characterization of SPBC20F10.02c deletion mutants?

Based on phenotypic characterization approaches described in source for similar S. pombe gene deletions:

Phenotypic Assay Selection:

  • Growth assays: Monitor growth curves in various media and conditions

  • Stress resistance tests: Examine sensitivity to temperature, oxidative stress, and DNA damage

  • Microscopy analysis: Assess cell morphology, division patterns, and subcellular structures

  • Spore formation and germination: Analyze efficiency and timing of sporulation processes

Experimental Design Principles:

  • Include multiple biological replicates: At least three independent experiments

  • Perform technical replicates: Minimum of three per biological replicate

  • Use appropriate statistical tests: Select tests based on data distribution and experimental design

  • Implement blind analysis: When possible, code samples to eliminate observer bias

Data Presentation:

  • Growth curves: Plot OD600 vs. time with error bars representing standard deviation

  • Spot tests: Serial dilutions on plates under different conditions

  • Quantitative image analysis: For microscopy and morphological assessments

  • Statistical significance: Report p-values and use appropriate multiple testing corrections

How should I interpret transcriptomic changes for SPBC20F10.02c under different conditions?

When analyzing transcriptomic data for SPBC20F10.02c:

Data Preprocessing:

  • Quality filtering: Remove genes with low expression (minimum of 2 CPM as mentioned in )

  • Normalization: Apply appropriate normalization methods for RNA-seq data

  • Batch effect removal: Correct for technical variation between sequencing runs

Differential Expression Analysis:

  • Statistical framework: Use tools like DESeq2 or edgeR for identifying differentially expressed genes

  • Multiple testing correction: Apply FDR or Benjamini-Hochberg correction

  • Fold change thresholds: Consider both statistical significance and biological relevance

Interpretation Framework:

  • Co-expression patterns: Identify genes with similar expression patterns

  • Pathway enrichment: Determine biological processes enriched among co-expressed genes

  • Temporal dynamics: Analyze time-course data to understand expression kinetics

  • Cross-condition comparison: Compare expression changes across different experimental conditions

What approaches should I use to study SPBC20F10.02c in spore formation and germination?

The study of SPBC20F10.02c in spore biology requires specialized techniques as evidenced from research on S. pombe spores in source :

Spore Preparation Protocol:

  • Induction of sporulation: Using nitrogen-limited media or temperature shifts

  • Spore isolation: Density gradient centrifugation or enzymatic digestion of asci

  • Purification: Ensure high purity of spore preparations

  • Aging studies: Store spores at different temperatures (4°C, 25°C) to study aging effects

Germination Analysis:

  • Inoculation in rich media: Transfer spores to favorable growth conditions

  • Microscopy monitoring: Track morphological changes during germination

  • Viability assessment: Measure colony-forming units at different time points

  • Transcriptomic analysis: Compare gene expression between germinating spores and vegetative cells

Heat Shock Studies:
From source , heat shock experiments on spores revealed:

  • Transcriptional differences between heat-shocked and non-stressed spores

  • Potential effects on subsequent germination and growth

  • Differences in chronological lifespan of spores subjected to heat stress

How can systematic genetic screens be designed to identify functional partners of SPBC20F10.02c?

Based on bar-seq approaches mentioned in source , systematic genetic screens can provide valuable insights:

Screening Methodologies:

  • Bar-seq from spores: Use barcoded deletion libraries to identify genetic interactions

  • Double mutant analysis: Create double mutants with SPBC20F10.02c deletion and other genes

  • Synthetic genetic array (SGA): Systematic creation and analysis of double mutants

  • Suppressor screens: Identify mutations that suppress SPBC20F10.02c deletion phenotypes

Experimental Design Considerations:

  • Library preparation: Follow established protocols for preparing DNA and constructing sequencing libraries

  • Barcode identification: Develop robust bioinformatic pipelines for barcode mapping

  • Differential abundance analysis: Compare mutant abundances between conditions

  • Validation strategy: Confirm identified interactions with targeted experiments

What approaches should be used to analyze SPBC20F10.02c from an evolutionary perspective?

Evolutionary analysis of SPBC20F10.02c can provide insights into its functional significance:

Methodological Approaches:

  • Sequence alignment: Compare homologs across species (human C10orf76, mouse 9130011E15Rik, etc.)

  • Phylogenetic analysis: Construct trees to understand evolutionary relationships

  • Selection pressure analysis: Calculate dN/dS ratios to identify conserved functional domains

  • Structural prediction: Use comparative modeling to predict structural conservation

Data Interpretation:

  • Conservation hotspots: Identify highly conserved regions likely critical for function

  • Species-specific adaptations: Detect lineage-specific changes suggesting functional specialization

  • Domain architecture: Compare domain organization across species

  • Correlation with phenotypes: Link evolutionary patterns to known phenotypic differences between species

The evolutionary conservation across diverse species from fungi to humans suggests that SPBC20F10.02c likely performs a fundamental cellular function that has been maintained throughout eukaryotic evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.