Recombinant Schizosaccharomyces pombe UPF0591 membrane protein C15E1.02c (SPAC15E1.02c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate this during order placement; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please specify this; we will prioritize its inclusion in the manufacturing process.
Synonyms
SPAC15E1.02c; UPF0591 membrane protein C15E1.02c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPAC15E1.02c
Target Protein Sequence
MPSYTHMPYVRPSAILLGIAFDHAASFLVYGPLMGDIWKRAMSTAPHVEYDAGSKTKKVA TTYVSNFLSTAVQSYSIAALLQLTGTVTLKGAFFVGLYVFGASGLPDVVDYMFTESRGTP YILVKTISSLVKSVGLSVALIGYGVRRI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0591 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is SPAC15E1.02c typically expressed as a recombinant protein?

Recombinant SPAC15E1.02c is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The protein is generally supplied as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE . For optimal results, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What are optimal conditions for expressing membrane proteins like SPAC15E1.02c in E. coli?

Membrane protein expression requires careful optimization. Based on experimental design approaches for recombinant protein expression, the following parameters should be considered:

ParameterRecommended Range for Membrane ProteinsNotes
Temperature16-30°CLower temperatures often yield better folding
Media compositionLB, TB, or defined media with supplementsMedia enriched with glycerol can improve membrane protein yields
Induction time4-6 hoursLonger times may not increase productivity
Cell density at inductionOD600 0.6-0.8Inducing at mid-log phase is often optimal
Growth phase for harvestBefore glucose exhaustionCritical to harvest before diauxic shift
IPTG concentration0.1-1.0 mMLower concentrations may improve folding

It's crucial to note that the most rapid growth conditions are not necessarily the optimal production conditions for membrane proteins. Instead, tightly controlled growth conditions with harvest prior to glucose exhaustion, just before the diauxic shift, have been shown to significantly improve membrane protein yields .

What strategies can improve the solubility of recombinant SPAC15E1.02c?

Improving the solubility of membrane proteins like SPAC15E1.02c requires specific approaches:

  • Fusion tags selection: His-tags are commonly used, but other solubility-enhancing tags like MBP or SUMO can be beneficial .

  • Detergent screening: A systematic approach is recommended, testing multiple detergents:

Detergent ClassExamplesTypical Concentration Range
Non-ionicDDM, OG, Triton X-1001-2x CMC
ZwitterionicLDAO, CHAPS3-5x CMC
Mixed micellesDDM+CHSVariable
  • Expression temperature: Lower temperatures (16-20°C) often improve folding of membrane proteins .

  • Co-expression with chaperones: Can assist with proper folding of complex membrane proteins.

  • Use of experimental design methodology: Factorial designs have successfully optimized bioprocesses for recombinant proteins, allowing systematic evaluation of variables like temperature, media composition, and induction conditions with fewer experiments .

How can I study the potential role of SPAC15E1.02c in S. pombe membrane dynamics?

Studying membrane proteins in S. pombe requires specialized techniques:

  • Localization studies: GFP fusion proteins have been successfully used in S. pombe to determine subcellular localization of membrane proteins. For example, studies with Spo3, another S. pombe membrane protein, used GFP fusion to reveal localization to the forespore membrane .

  • Protein-protein interactions: To investigate potential interaction partners of SPAC15E1.02c, consider:

    • Tandem Affinity Purification (TAP) followed by mass spectrometry

    • Yeast two-hybrid analysis specifically designed for membrane proteins

    • Co-immunoprecipitation with appropriate detergent solubilization

  • Functional analysis: Gene deletion followed by phenotypic analysis can reveal functional roles. In S. pombe, this approach has been used to characterize membrane proteins involved in various cellular processes including sporulation and membrane formation .

  • Bioinformatic analysis: Comparison with UPF0591 family proteins in other organisms may provide functional clues based on conserved domains or sequence motifs.

How do I resolve contradictory data when working with recombinant SPAC15E1.02c?

When facing contradictory experimental results with SPAC15E1.02c, systematic analysis of contextual factors is essential. A study on contradictions in biomedical literature identified five main categories of contextual characteristics that explain apparent contradictions :

  • Internal to the subject: Species differences, genetic background variations

  • External to the subject: Experimental conditions, reagents used

  • Endogenous/exogenous factors: Post-translational modifications, protein-protein interactions

  • Known controversy: Established scientific debates about the protein's function

  • Contradictions in literature: Methodological differences between studies

For recombinant membrane proteins specifically, consider:

  • Expression system variations: E. coli vs. yeast expression systems may yield proteins with different folding or modifications

  • Purification method differences: Detergent selection can dramatically affect protein structure and function

  • Buffer composition effects: pH, salt concentration, and presence of stabilizing agents

To resolve contradictions, create a systematic table documenting all experimental variables:

VariableExperiment AExperiment BPotential Impact
Expression hostE. coliS. pombePost-translational modifications
Purification methodNativeDenaturing/refoldingProtein conformation
Buffer compositionpH 7.4, 150mM NaClpH 6.8, 100mM NaClProtein stability, interactions
Temperature25°C30°CEnzymatic activity, stability
Protein concentration0.1 mg/ml1.0 mg/mlAggregation, oligomerization

What can alternative splicing analysis tell us about SPAC15E1.02c expression?

Recent studies using single-molecule real-time (SMRT) sequencing based on Pacific Biosciences (PacBio) platform have revealed complex alternative splicing patterns in S. pombe . While specific data for SPAC15E1.02c is limited in the search results, understanding alternative splicing patterns may provide insights into potential isoforms:

  • Potential for alternative isoforms: Analysis software like SpliceHunter can systematically explore the transcriptome to identify alternative splicing events including exon skipping, intron inclusion, and novel exons .

  • Temporal expression patterns: Research has shown that some S. pombe genes have alternative isoforms expressed in mitosis versus meiosis . Given that many membrane proteins show condition-specific expression, SPAC15E1.02c may have uncharacterized splice variants.

  • Methodological approach: To investigate SPAC15E1.02c isoforms:

    • Collect RNA samples across different conditions (vegetative growth, meiosis, stress)

    • Use PCR amplification to test intron retention levels

    • Consider full-length cDNA sequencing using long-read technologies

How might SPAC15E1.02c contribute to membrane dynamics during the S. pombe cell cycle?

S. pombe provides an excellent model for studying membrane dynamics during cell division and sporulation. The role of SPAC15E1.02c can be investigated in the context of known membrane-related processes:

  • Potential role in membrane biogenesis: Several S. pombe membrane proteins, such as Spo3, are critical for forespore membrane assembly during sporulation . SPAC15E1.02c could potentially contribute to membrane formation or remodeling.

  • Cell cycle-regulated expression: Analysis of expression timing relative to cell cycle phases (using cdc2asM17 ATP-analogue sensitive allele for synchronization) can reveal when SPAC15E1.02c is most active .

  • Interaction with membrane trafficking machinery: Many membrane proteins in S. pombe interact with components of vesicle transport pathways. For example, Spo3 genetically interacts with Psy1, a syntaxin-like protein involved in membrane fusion .

  • Localization during cell division: GFP-tagging and live cell imaging during the cell cycle could reveal dynamic localization patterns, similar to observations that Psy1 relocates from the plasma membrane to the forespore membrane during sporulation .

What methodological approaches can characterize the chromatin environment of the SPAC15E1.02c locus?

Understanding the chromatin context of SPAC15E1.02c can provide insights into its regulation:

  • Histone modification analysis: Studies have shown various histone modifications can affect gene expression in S. pombe. For example, H2A.z underacetylation at histone H4 has been associated with specific chromatin environments .

  • Chromatin modifiers: Investigate potential regulation by chromatin modifiers such as the HIRA histone chaperone complex, which has been shown to repress specific sets of genes .

  • Subtelomeric positioning effects: If SPAC15E1.02c is located near subtelomeric regions, it may be subject to position-dependent regulation, as genes in these regions can be coordinately regulated .

  • Methodological approach:

    • Chromatin immunoprecipitation (ChIP) to assess histone modifications

    • Analysis of expression in strains lacking specific chromatin modifiers

    • Investigation of long-range chromatin interactions

How can I design experiments to study potential roles of SPAC15E1.02c in stress response?

Many membrane proteins in S. pombe are involved in stress responses. To investigate SPAC15E1.02c's potential role:

  • Stress condition screening: Systematically test phenotypes of SPAC15E1.02c deletion or overexpression strains under various stresses:

Stress ConditionMethodologyMeasured Parameters
Osmotic stressGrowth in media with varying sorbitol concentrationsGrowth rate, morphology changes
Cell wall stressCalcofluor white, Congo red exposureCell integrity, septation defects
Nutrient limitationNitrogen/carbon starvationQuiescence entry, survival rates
Temperature stressGrowth at elevated temperatures (36-38°C)Protein localization, aggregation
Cytoplasmic freezingDeep starvation conditions Cytoplasmic mobility, protoplast shape
  • Transcriptional response: Compare transcriptome changes in wild-type vs. SPAC15E1.02c mutant strains under stress conditions using RNA-seq.

  • Protein interaction changes: Investigate whether stress conditions alter SPAC15E1.02c's interaction partners, localization, or post-translational modifications.

What are the critical storage and handling considerations for recombinant SPAC15E1.02c?

For optimal results with recombinant SPAC15E1.02c:

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles (not recommended)

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to 5-50% final concentration for long-term storage

    • Default recommended glycerol concentration is 50%

  • Buffer considerations:

    • Supplied in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • When changing buffers, consider membrane protein stability

How can I validate the structural integrity of recombinant SPAC15E1.02c after purification?

Validating membrane protein structural integrity requires specialized approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.