Recombinant Schizosaccharomyces pombe UPF0620 protein C83.10 (SPBC83.10)

Shipped with Ice Packs
In Stock

Description

General Information

Schizosaccharomyces pombe (fission yeast) serves as a model organism in molecular and cell biology and is also used in traditional brewing . Recombinant Schizosaccharomyces pombe UPF0620 protein C83.10, also known as SPBC83.10, is a protein of unknown function belonging to the UPF0620 protein family .

  • UniProt Accession Number: O94694

  • Other Names: UPF0620 protein C83.10

  • Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Function and Characteristics

The Schizosaccharomyces pombe UPF0620 protein C83.10 (SPBC83.10) is a protein with a currently unknown function . Proteins of the UPF0620 family are conserved across various species, but their specific roles often remain unclear. Research indicates SPBC83.10 may play a role in cell wall integrity and morphogenesis, similar to other proteins involved in these processes in S. pombe .

Production and Availability

Recombinant SPBC83.10 protein can be produced in various expression systems, including:

  • Yeast

  • E. coli

  • Baculovirus

  • Mammalian cells

The recombinant protein is available for purchase from various commercial sources for research purposes . It can be obtained with modifications such as an Avi-tag for biotinylation .

Involvement in Cellular Processes

S. pombe possesses two genes, rho1+ and rho2+, which participate in controlling cell morphogenesis, maintaining cell integrity, and polarizing the actin cytoskeleton . Rho GTPases are essential modulators in eukaryotes, coordinating cell wall biosynthesis and actin organization to maintain cell integrity and polarized growth .

Rho2p, a GTPase, regulates the synthesis of α-d-glucan, a key structural polymer in the S. pombe cell wall, primarily through Pck2p . Overexpression of rho2+ leads to a thicker cell wall, and cells overproducing Rho2p show increased total cell wall incorporation, specifically an increase in α-glucan .

Protein Interactions

SPBC83.10's interactions can be explored through databases such as STRING, which provides information on known and predicted protein-protein interactions . Such interactions can provide insights into the protein's function and its role in cellular pathways.

Cell Wall Composition Analysis of S. pombe Mutants

StrainTotal Cell Wall Incorporationα-Glucan (%)
Wild-type29.810.0
pREP1-rho2 (16h)38.917.2

Key Protein Interactions in CIII₂CIV Supercomplex

SubunitInteracting SubunitInteraction Residues (S. pombe)
Cor1Cox5Lys274 - Asp50
Cor1Cox5Thr26 - Arg45

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SPBC83.10; UPF0620 protein C83.10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-189
Protein Length
Full Length of Mature Protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC83.10
Target Protein Sequence
AEVYGKVLTNTILPKINLLSYDTRARLISSNKTFETVVERDGSFTFPNVPDEIYFLRLES IDYEFSEFHIIINESIVYPYYTSPAEKRPASSTAKNTSYPIKVRAVLKRDYLKEPRKFSL IRLLKSPMMLLSLASVVLVFILPKLNIEAKALEQARLAEAAEKKTA
Uniprot No.

Target Background

Database Links
Protein Families
UPF0620 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

Basic Research Questions

  • Is SPBC83.10 an essential gene in S. pombe?

    The search results do not specifically indicate whether SPBC83.10 is essential. To determine essentiality, researchers would follow methodology described in Kim et al. (2010), which involved constructing heterozygous diploid deletion mutants, inducing sporulation, and analyzing the viability of resulting haploid spores .

    Researchers investigating this question should:

    • Create heterozygous deletion in diploid strains through homologous recombination

    • Induce sporulation and perform tetrad analysis

    • Examine haploid progeny viability to determine essentiality

    • Compare results with the pattern of essential genes in S. pombe, where 26.1% of genes (1,260/4,836) were found to be essential

  • How does SPBC83.10 compare with similar proteins in other yeast species?

    While the search results don't provide direct orthologs of SPBC83.10, a methodological approach to this question would involve:

    • Performing BLAST or HMM-based searches to identify potential orthologs in other species

    • Conducting comparative genomic analysis between S. pombe and S. cerevisiae, as detailed in the genome-wide deletion study

    • Examining whether the gene falls into the category of 83% of orthologous pairs that have conserved dispensability between fission and budding yeasts

    • Determining if SPBC83.10 is species-specific, as were 1,140 genes identified in fission yeast that were not conserved in budding yeast

Advanced Research Questions

  • What approaches should be used to determine the function of this uncharacterized protein?

    For characterizing UPF0620 protein C83.10, researchers should employ multiple complementary approaches:

    • Genetic analysis: Create deletion mutants using PCR-based gene deletion procedures as described in the genome-wide deletion study . Analyze phenotypes under various conditions.

    • Protein localization: Use GFP tagging and live microscopy cell imaging as described in source to determine subcellular localization. This approach was used successfully for other S. pombe proteins like Sts5.

    • Protein-protein interactions: Apply techniques described in source to identify interaction partners:

      • Yeast two-hybrid

      • Co-immunoprecipitation

      • Protein network analysis to identify "linker" proteins that bridge diverse cellular processes

    • Comparative proteomics: Implement the isobaric labeling/two-dimensional LC-MALDI MS approach described in source to analyze proteomic changes in strains with SPBC83.10 deletion or overexpression.

    • Transcriptional analysis: Employ quantitative RT-PCR with specific primers as described in source to examine expression patterns under different conditions.

  • How should researchers approach recombinant expression and purification of SPBC83.10?

    Based on the available product information and expression research methodologies , researchers should consider:

    Expression Systems:

    • Mammalian cell expression (as used in commercial products)

    • E. coli expression (potential alternative for high yield)

    • Baculovirus expression system (as used successfully for other S. pombe proteins)

    Optimization Protocol:

    1. Apply experimental design approach as described in source :

      • Optimize induction conditions (temperature, inducer concentration, time)

      • Test different media compositions

      • Apply factorial design to efficiently test multiple variables

    2. For S. pombe specific proteins, consider findings from source :

      • Address amino acid availability bottlenecks

      • Consider membrane fluidity for secreted proteins

    3. Purification strategy:

      • Implement tag-based affinity purification

      • Add further purification steps to achieve >85% purity (as noted in commercial products)

      • Optimize buffer composition for stability

    Storage Recommendations:

    • Store at -20°C/-80°C in 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Keep working aliquots at 4°C for up to one week

  • How is SPBC83.10 potentially regulated in response to cellular conditions?

    While specific regulatory mechanisms for SPBC83.10 are not described in the search results, researchers can investigate this question using methodologies derived from studies of other S. pombe proteins:

    • Iron-dependent regulation: Based on the regulatory framework described in source , examine whether SPBC83.10 expression changes under varying iron conditions.

    • Cell cycle regulation: Employ approaches from source to determine if SPBC83.10 shows cell cycle-dependent expression or localization patterns.

    • Response to environmental stress: Apply methods from source to investigate how "culture memory" and environmental stresses affect SPBC83.10 expression or activity.

    • Post-translational regulation: Examine whether SPBC83.10 is regulated by conserved regulatory mechanisms similar to those of spGrx4, spFep1, and spPhp4 described in source .

    The experimental approach should include quantitative RT-PCR under various conditions and western blot analysis to examine protein levels and potential modifications.

  • What are the implications of the protein's predicted structure for functional studies?

    According to source , a methodological approach to protein structure prediction involves:

    • Using the Phyre2 online webserver (sbg.bio.ic.ac.uk/phyre2/) for protein prediction and modeling in intensive mode

    • Analyzing protein-protein interactions using the STRING database (https://string-db.org)

    • Visualizing predicted structures with rainbow colors from N to C terminus

    While specific structural information for SPBC83.10 is not provided, researchers should apply these methods to predict secondary and tertiary structure, which could provide insights into:

    • Potential functional domains

    • Protein interaction surfaces

    • Membrane association (suggested by the sequence characteristics)

    • Structural homology to proteins of known function

Experimental Methodology Questions

  • What approaches should be used to generate antibodies against SPBC83.10?

    For antibody generation against SPBC83.10, researchers should consider:

    1. Antigen preparation:

      • Use recombinant SPBC83.10 as described in sources and

      • Ensure high purity (>85% by SDS-PAGE)

      • Consider using either full-length protein or specific peptides based on predicted antigenic regions

    2. Antibody production strategies:

      • Monoclonal antibodies: For high specificity and reproducibility

      • Polyclonal antibodies: For robust detection across multiple epitopes

      • Consider using tags (mentioned in source ) for initial purification and detection

    3. Validation methods:

      • Western blot against recombinant protein and native S. pombe extracts

      • Immunoprecipitation followed by mass spectrometry

      • Immunofluorescence with appropriate controls (including deletion strains)

      • Preabsorption with recombinant protein to confirm specificity

  • How should researchers design deletion mutants for SPBC83.10 functional studies?

    Based on the methodology described in sources and , researchers should:

    1. Design deletion strategy:

      • Use PCR-based gene targeting methods with appropriate selectable markers

      • Include unique molecular barcodes for future pooled experiments

      • Ensure deletion of >80% of the ORF to prevent residual activity

    2. Validation of deletion:

      • Confirm replacement with marker gene using PCR and sequencing

      • Perform Southern blot analysis to check for additional integrations

      • Verify absence of protein expression by Western blot

    3. Phenotypic analysis:

      • Compare growth rates across different media conditions

      • Examine cell morphology, cell cycle progression, and response to stressors

      • Consider transcriptome analysis to identify affected pathways

  • What methods should be used to study SPBC83.10 in the context of the S. pombe proteome?

    For proteomic studies involving SPBC83.10, researchers should consider the methodology outlined in source :

    1. Sample preparation:

      • Prepare total cell lysates using denaturing buffer containing protease inhibitors

      • Disrupt cells using glass beads in an oscillating mill device

      • Determine protein concentration by Bradford assay

    2. Comparative proteomics approach:

      • Apply isobaric labeling (iTRAQ) for quantitative comparison

      • Use two-dimensional LC coupled offline to MALDI MS

      • Implement a global internal standard approach

    3. Data analysis:

      • Look for changes across biological pathways

      • Compare results with known protein-protein interaction networks

      • Integrate findings with transcriptomic data for systems-level understanding

  • How can researchers investigate potential post-translational modifications of SPBC83.10?

    To identify and characterize potential post-translational modifications (PTMs), researchers should:

    1. Computational prediction:

      • Use specialized software to predict potential phosphorylation, glycosylation, or other modification sites

      • Compare with known modification patterns in related proteins

    2. Experimental detection:

      • Employ mass spectrometry-based proteomics as described in source

      • Use phospho-specific antibodies if phosphorylation is predicted

      • Apply specific staining methods for glycosylation

    3. Functional significance:

      • Create site-specific mutants at predicted modification sites

      • Compare activity, localization, and interactions between wild-type and mutant proteins

      • Examine modification status under different cellular conditions

  • What approaches would be effective for analyzing SPBC83.10 in genetic interaction studies?

    Based on methodologies presented in sources , , and , researchers should:

    1. Design genetic interaction screens:

      • Create double mutants with genes in related pathways

      • Use the genome-wide deletion resource (covering 98.4% of genes)

      • Look for synthetic lethality, suppression, or enhancement

    2. Focus on specific pathways:

      • Consider interactions with cell integrity pathways (based on findings with pck1p and pck2p)

      • Examine potential connections to iron regulation pathways

      • Investigate links to cell polarity and cell cycle regulation

    3. Analysis frameworks:

      • Apply network theory measures to identify "linker" proteins

      • Integrate genetic interaction data with protein-protein interaction networks

      • Use GO term enrichment to identify biological processes affected

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.