Recombinant Schizosaccharomyces pombe UPF0644 protein PB2B4.06 (SPAPB2B4.06)

What is the basic structure and sequence information for UPF0644 protein PB2B4.06?

UPF0644 protein PB2B4.06 (SPAPB2B4.06) is a conserved fungal protein from Schizosaccharomyces pombe with UniProt accession number Q9HDW5. The full amino acid sequence consists of 256 amino acids as follows: MGIASSLRLFGKAPASYLFNGFRRQMKNPLMKKGVVYAGVSGTCAAAGYMFGNFVMEKHIYQVKYTEEQEKEVLEVENRLQNLKIVKDLRQNPSFRELRMPFNRSNHSLTNNLLSGPGRITVPPVIFYDKSTRQVYAIAHVGKDVGLDDDTIHPGLIATCMDEVLAICSFLSLPNKIAVTANLKLSNPTKAYTNH FYILRSHLEWTKGRK AQTHGTAYMLDNEDPSKSTCVAIADGLFVEPRFAKYLKHVIPVSLP . The expression region covers amino acids 1-256, representing the full-length protein .

What are the optimal storage conditions for recombinant SPAPB2B4.06 protein?

The recombinant protein should be stored in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . For short-term storage, working aliquots can be kept at 4°C for up to one week. For extended storage, the protein should be maintained at -20°C or -80°C . It is important to note that repeated freezing and thawing is not recommended as it may compromise protein integrity and activity . The best practice is to prepare small working aliquots upon first thawing to minimize freeze-thaw cycles.

What is currently known about the function of SPAPB2B4.06 in S. pombe?

The function of SPAPB2B4.06 is not fully characterized, but it is classified as a conserved fungal protein that may be involved in transcriptional processes . Limited information suggests potential involvement in ternary complex assembly and transcription in S. pombe . The protein belongs to the UPF0644 family, which consists of uncharacterized proteins with functions that have not been experimentally determined. Researchers are still investigating its precise biological role through various experimental approaches, including genetic interaction studies and localization experiments.

What are the recommended methods for expressing recombinant SPAPB2B4.06 protein?

For efficient expression of recombinant SPAPB2B4.06, a bacterial expression system using E. coli is commonly employed . When designing expression constructs, it is advisable to include affinity tags such as His-tag for easier purification . The expression protocol should consider the following key parameters:

• Optimal induction conditions (IPTG concentration, temperature, and duration)

• Cell lysis methods that preserve protein structure

• Buffer composition optimized for protein stability

For S. pombe proteins that are difficult to express in E. coli, alternative expression systems such as yeast expression systems may be considered, particularly when post-translational modifications are critical for function.

How can metabolic flux analysis be applied to study the impact of SPAPB2B4.06 expression?

Metabolic flux analysis using 13C labeling can be applied to study the metabolic burden associated with SPAPB2B4.06 expression in S. pombe. Based on studies of protein secretion in S. pombe, researchers should:

• Construct strains expressing SPAPB2B4.06 at different levels

• Quantify the influence on metabolism using 13C-based metabolic flux analysis in chemostat cultures

• Analyze macromolecular biomass composition, particularly lipid content, as protein expression levels increase

• Monitor metabolic fluxes in the pentose phosphate pathway, TCA cycle, and around the pyruvate node

• Assess changes in mitochondrial NADPH supply which may be altered due to protein expression burden

This approach would help understand the metabolic adjustments required for efficient expression of SPAPB2B4.06 and identify potential metabolic bottlenecks.

What transcriptomic approaches are useful for studying SPAPB2B4.06 function?

For transcriptomic analysis of SPAPB2B4.06 function, several methodologies are recommended:

• RNA isolation using commercially available kits such as the High Pure RNA Isolation kit

• Quantitative RT-PCR using systems like FastStart SYBR Green Master kit and appropriate primers designed specifically for SPAPB2B4.06 and reference genes (e.g., act1)

• Precision Run-On sequencing (PRO-Seq) to capture nascent transcripts and understand transcription dynamics

• RNA-Seq for comprehensive gene expression profiling, particularly to identify genes differentially expressed in SPAPB2B4.06 deletion strains compared to wild-type

Designing appropriate primers for SPAPB2B4.06 is critical for accurate quantification. Typical forward and reverse primers should target unique regions of the gene to ensure specificity.

How might SPAPB2B4.06 interact with transcriptional machinery in S. pombe?

Based on research into transcriptional regulation in S. pombe, SPAPB2B4.06 may potentially interact with RNA polymerase II and associated complexes. To investigate these interactions, researchers should consider:

• Chromatin immunoprecipitation followed by sequencing (ChIP-seq) to map genomic binding sites of SPAPB2B4.06

• Co-immunoprecipitation (Co-IP) experiments to identify protein interaction partners

• Yeast two-hybrid screening to discover direct protein-protein interactions

• Structural studies to determine binding domains and interaction surfaces

Given its potential involvement in ternary complex assembly for transcription, researchers should specifically examine interactions with mediator complex components and other transcriptional regulators identified in S. pombe .

What genetic interaction studies would be most informative for understanding SPAPB2B4.06 function?

To elucidate the functional role of SPAPB2B4.06 through genetic interactions, researchers should consider:

• Systematic genetic array (SGA) analysis using SPAPB2B4.06 deletion strains crossed with a genome-wide deletion library

• Analysis of synthetic genetic interactions, particularly with transcription-related genes

• Investigation of potential interactions with chromatin modifiers, especially those involved in gene silencing like swi6+, rik1+, and clr4+

• Temperature sensitivity assays of double mutants to identify conditional genetic interactions

• UV sensitivity testing in combination with DNA damage response genes such as rad9Δ

The table below outlines potential genetic interaction experiments and expected outcomes:

How can structural biology approaches be applied to study SPAPB2B4.06?

Advanced structural biology approaches for studying SPAPB2B4.06 include:

• Protein structure prediction using tools like Phyre2 online webserver (sbg.bio.ic.ac.uk/phyre2/) in intensive mode

• X-ray crystallography of purified recombinant protein to determine high-resolution structure

• Cryo-electron microscopy (cryo-EM) for visualization of SPAPB2B4.06 in complex with interaction partners

• Nuclear magnetic resonance (NMR) spectroscopy for studying protein dynamics and ligand interactions

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify flexible regions and binding interfaces

Obtaining high-quality purified protein is a prerequisite for these structural studies. The recombinant protein with affinity tags can facilitate purification while carefully optimized buffer conditions will ensure protein stability during structural analysis .

What approaches can be used to study SPAPB2B4.06 localization in S. pombe cells?

To determine the subcellular localization of SPAPB2B4.06, researchers should employ:

• Construction of epitope-tagged strains using methods described for S. pombe protein tagging

• Fluorescent protein fusion (e.g., GFP, mCherry) for live-cell imaging

• Immunofluorescence microscopy using specific antibodies against SPAPB2B4.06 or its epitope tag

• Cell fractionation followed by Western blotting to detect SPAPB2B4.06 in different cellular compartments

• Co-localization studies with known markers of nuclear, cytoplasmic, and organelle compartments

These approaches would help determine whether SPAPB2B4.06 localizes to specific cellular compartments such as the nucleus (suggesting direct involvement in transcription) or cytoplasm (suggesting potential regulatory roles).

How might SPAPB2B4.06 function be related to iron homeostasis in S. pombe?

Iron homeostasis regulation in S. pombe involves proteins like Grx4, Fep1, and Php4 . To investigate potential roles of SPAPB2B4.06 in iron homeostasis:

• Culture SPAPB2B4.06 deletion strains in media with varying iron concentrations (0.25, 0.5, 3, or 6.0 mM Fe2(SO4)3)

• Prepare serial dilutions for spot assays to assess growth under different iron conditions

• Measure expression of iron-responsive genes in wild-type versus SPAPB2B4.06 deletion strains

• Analyze potential protein-protein interactions between SPAPB2B4.06 and known iron regulators using techniques like the STRING database

• Investigate phenotypic changes in response to iron limitation or excess in strains with SPAPB2B4.06 mutations

If SPAPB2B4.06 is involved in iron homeostasis, deletion strains may show altered sensitivity to iron levels, changed expression of iron-regulated genes, or modified interaction networks with known iron regulators.

What metabolic pathways might be affected by SPAPB2B4.06 in S. pombe?

Based on studies of protein expression impact on S. pombe metabolism, researchers investigating SPAPB2B4.06's effects on metabolic pathways should:

• Examine alterations in the pentose phosphate pathway, which provides NADPH for biosynthetic reactions

• Investigate changes in TCA cycle flux, which may be modulated in response to protein expression burden

• Analyze flux around the pyruvate node, including mitochondrial NADPH supply

• Assess cellular lipid content, which may increase with elevated protein expression

• Evaluate the impact of supplementing growth media with acetate alongside glucose or glycerol, which might improve protein production through increased TCA cycle flux and mitochondrial NADPH production

These analyses would help understand how SPAPB2B4.06 expression influences cellular metabolism and identify strategies to optimize its production in research settings.

What are the key considerations for designing deletion mutants of SPAPB2B4.06?

When creating SPAPB2B4.06 deletion mutants in S. pombe, researchers should consider:

• Selection of appropriate deletion strategy based on homologous recombination techniques

• Design of primers that target the entire open reading frame (ORF) while preserving regulatory regions

• Verification of successful deletion through PCR, sequencing, and expression analysis

• Creation of marker-free deletions to avoid interference from selection markers

• Construction of complementation strains to confirm that observed phenotypes are directly attributable to SPAPB2B4.06 deletion

The deletion construct design should ensure complete removal of the coding sequence while minimizing disruption to neighboring genes or regulatory elements. Verification of the deletion mutant is critical before proceeding with phenotypic analysis.

What quality control measures are essential when working with recombinant SPAPB2B4.06?

To ensure the integrity and functionality of recombinant SPAPB2B4.06 protein preparations, implement these quality control measures:

• SDS-PAGE analysis to confirm protein purity and expected molecular weight (approximately 28-30 kDa based on 256 amino acids)

• Western blotting with specific antibodies or against affinity tags to verify protein identity

• Mass spectrometry to confirm the primary sequence and detect any post-translational modifications

• Size-exclusion chromatography to assess protein oligomerization state and homogeneity

• Circular dichroism (CD) spectroscopy to evaluate secondary structure content and proper folding

• Thermal shift assays to determine protein stability under various buffer conditions

These quality control steps are essential before proceeding with functional or structural studies to ensure that experimental results accurately reflect the properties of properly folded SPAPB2B4.06.

How can researchers optimize expression of SPAPB2B4.06 for structural and functional studies?

For optimal expression of SPAPB2B4.06 for downstream applications, researchers should:

• Test multiple expression systems (bacterial, yeast, insect cells) to identify the most efficient production platform

• Optimize codon usage for the selected expression host to enhance translation efficiency

• Evaluate different affinity tags (His, GST, MBP) for their impact on protein solubility and function

• Experiment with induction conditions (temperature, inducer concentration, duration) to maximize yield without compromising protein quality

• Develop a purification strategy that includes multiple chromatography steps to achieve high purity

• Screen buffer compositions to identify conditions that enhance protein stability and prevent aggregation

Additionally, supplementing growth media with acetate alongside glucose or glycerol might improve protein production through increased TCA cycle flux and mitochondrial NADPH production, as demonstrated for other S. pombe proteins .