Recombinant Schizosaccharomyces pombe UPF0645 membrane protein C20H4.02 (SPAC20H4.02)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if you have special requirements. We will fulfill requests based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
dsc3; SPAC20H4.02; DSC E3 ubiquitin ligase complex subunit 3; Defective for SREBP cleavage protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
dsc3
Target Protein Sequence
MSSSALKKWEIVIRFASSIPDLSLEISDAQTTTIHSLFKIVRNRIPECRDKQLKMVFQGR LLSPGFTVERAVRGNWQRDENDDPNIVQKAFIHCIVGPTLTEEELASQDQAQSGLNSNSE SPDDLQNAQTGETLRGFDRLREAGFTETEVNNLRSQFHRLRGTNLDSLTEDAIREAEDDW IDNGGQNSSADELDMSYETLLAGVLIGFFGGAIACYFLWERTMFSLRMQLSILVGIICNF AYGLLHSYRW
Uniprot No.

Target Background

Function
Recombinant *Schizosaccharomyces pombe* UPF0645 membrane protein C20H4.02 (SPAC20H4.02) is a component of the DSC E3 ubiquitin ligase complex. This complex is essential for the proteolytic cleavage of the sre1 transcriptional activator, releasing the soluble transcription factor from the membrane under conditions of low oxygen or sterol. The complex also plays a significant role in the multivesicular body (MVB) pathway and functions in a post-endoplasmic reticulum pathway for protein degradation.
Database Links
Protein Families
Dsc3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is UPF0645 membrane protein C20H4.02 (SPAC20H4.02)?

UPF0645 membrane protein C20H4.02 is a 250-amino acid protein found in the fission yeast Schizosaccharomyces pombe (strain 972/ATCC 24843). It belongs to the UPF0645 protein family, a group of uncharacterized proteins with predicted membrane localization. The protein is encoded by the SPAC20H4.02 gene and has the UniProt accession number Q9HE10 . The "UPF" designation indicates it belongs to an "Uncharacterized Protein Family," meaning its precise biological function has not been fully elucidated. Based on sequence analysis, it contains hydrophobic regions consistent with transmembrane domains, particularly in the C-terminal portion.

What expression systems are most effective for producing recombinant UPF0645 membrane protein C20H4.02?

When expressing recombinant UPF0645 membrane protein C20H4.02, researchers should consider several expression systems, each with distinct advantages for membrane protein production:

Expression SystemAdvantagesLimitationsTypical Yield (μg/L)
E. coliRapid growth, low cost, scalabilityLimited post-translational modifications500-1000
S. cerevisiaeProper folding, eukaryotic modificationsLonger production time800-1500
S. pombeNative environment, authentic processingLower expression levels600-1200
Insect cellsHigh-quality eukaryotic expressionComplex setup, higher cost1000-2000

How does temperature affect experimental work with UPF0645 membrane protein C20H4.02?

Temperature significantly impacts both the stability and functional properties of proteins from S. pombe, including UPF0645 membrane protein C20H4.02. Research on temperature sensitivity in S. pombe has revealed important considerations for experimental design:

Temperature (°C)Effect on ProteinExperimental Implications
4High stability, minimal activitySuitable for storage, not functional assays
16Very stable, reduced activityUsed for slow-rate kinetic studies
25-30Optimal stability/activity balancePhysiologically relevant range for S. pombe
33Moderate stability, potentially altered functionUpper physiological limit
>37Rapidly decreasing stabilityDenaturation begins, avoid for functional studies

Studies on meiotic recombination in S. pombe have shown that cellular processes are sensitive to temperature changes between 16°C and 33°C, suggesting that DSB formation and processing may be temperature-dependent mechanisms . While specific data for UPF0645 membrane protein C20H4.02 is limited, researchers should carefully control and report experimental temperatures when working with this protein, as membrane fluidity changes with temperature may affect membrane protein dynamics.

What buffer conditions are optimal for functional assays with UPF0645 membrane protein C20H4.02?

Establishing appropriate buffer conditions is critical for maintaining the structural integrity and functional activity of membrane proteins. For UPF0645 membrane protein C20H4.02, consider the following:

Buffer ComponentRecommended RangePurpose
pH6.5-7.5Mimics cytoplasmic pH of S. pombe
Salt (NaCl or KCl)100-150 mMMaintains ionic strength
Buffer base20-50 mM Tris or HEPESProvides pH stability
Glycerol5-10% (50% for storage)Enhances protein stability
Reducing agent1-5 mM DTT or β-MEPrevents oxidation of cysteine residues
Detergent1-2× CMCMaintains membrane protein solubility

What control proteins should be included in experiments with UPF0645 membrane protein C20H4.02?

Rigorous experimental design requires appropriate controls to validate results and interpretations when studying UPF0645 membrane protein C20H4.02:

Positive controls:

  • Related membrane proteins from the same UPF0645 family (if available)

  • Well-characterized membrane proteins with similar topology from S. pombe

  • For functional assays, proteins with known activity in the relevant pathway

Negative controls:

  • Empty vector expression product

  • Irrelevant membrane protein with different subcellular localization

  • Denatured UPF0645 membrane protein C20H4.02

Specificity controls:

  • Mutant versions of UPF0645 membrane protein C20H4.02 with altered key residues

  • Truncated versions lacking specific domains

When possible, compare results between endogenous (native) and recombinant versions of the protein to verify that observed effects are not artifacts of the recombinant expression system or purification process. This multi-control approach enables robust interpretation of experimental findings and helps distinguish genuine biological effects from technical artifacts.

What purification strategies yield the highest purity recombinant UPF0645 membrane protein C20H4.02?

Purifying membrane proteins presents unique challenges due to their hydrophobic nature and requirement for detergents. For recombinant UPF0645 membrane protein C20H4.02, a multi-step strategy typically yields the best results:

Purification MethodTypical PurityRecovery (%)Notes
Single-step affinity75-85%60-70Fastest method, moderate purity
Two-step (affinity + SEC)90-95%40-50Good balance of purity and yield
Three-step (affinity + IEX + SEC)>98%25-35Highest purity, lower yield

The optimal purification protocol typically involves:

  • Membrane extraction using carefully selected detergents (typically mild non-ionic detergents)

  • Immobilized metal affinity chromatography (IMAC) if the protein contains a His-tag

  • Size exclusion chromatography (SEC) to separate the protein based on size and remove aggregates

  • Optional ion exchange chromatography (IEX) as a polishing step

Throughout purification, maintaining the membrane protein in an appropriate detergent or lipid environment is essential to prevent aggregation and denaturation . Purification buffers should typically include glycerol and sometimes specific lipids to mimic the native membrane environment.

How can researchers verify the structural integrity of purified UPF0645 membrane protein C20H4.02?

Confirming that purified UPF0645 membrane protein C20H4.02 maintains its native fold is essential before proceeding with functional studies. Several complementary techniques can assess structural integrity:

TechniqueInformation ProvidedSample RequirementLimitations
Circular Dichroism (CD)Secondary structure content0.1-0.5 mg/ml, 200 μlLimited structural detail
Fluorescence SpectroscopyTertiary structure assessment0.05-0.1 mg/ml, 100 μlRequires tryptophan residues
Size Exclusion ChromatographyAggregation state0.5-1 mg/ml, 100 μlLow resolution
Thermal Shift AssaysStability assessment0.1-0.2 mg/ml, 50 μlIndirect structure measurement
Limited ProteolysisDomain organization0.2-0.5 mg/ml, 100 μlDestructive technique

A multi-technique approach is recommended:

  • Initial assessment with CD to confirm secondary structure content matches prediction

  • Thermal stability assessment to establish working temperature range

  • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to verify monodispersity and oligomeric state

  • Limited proteolysis to confirm proper folding (well-folded proteins show discrete digestion patterns)

For UPF0645 membrane protein C20H4.02 specifically, the hydrophobic C-terminal region should be properly incorporated into detergent micelles or lipid environments, which can be assessed through detergent or lipid binding assays.

How can UPF0645 membrane protein C20H4.02 be used in meiotic recombination studies?

UPF0645 membrane protein C20H4.02 could serve as an interesting component in meiotic recombination studies, particularly given the temperature sensitivity of meiotic recombination in S. pombe. Research has shown that intragenic recombination in S. pombe is sensitive to environmental temperature changes, with temperature affecting both DSB formation and processing . While direct evidence for this specific protein's role in meiosis is limited, membrane dynamics play important roles in meiotic processes. Researchers could employ several approaches:

  • Gene knockout/knockdown studies:

    • Generate SPAC20H4.02 deletion mutants in S. pombe

    • Assess meiotic progression and recombination rates across temperature ranges (16-33°C)

    • Measure crossover frequencies and gene conversion events in mutant vs. wild-type strains

  • Localization studies:

    • Create fluorescently tagged versions of UPF0645 membrane protein C20H4.02

    • Track protein localization during different stages of meiosis

    • Determine whether localization patterns change with temperature shifts

  • Interaction studies:

    • Identify whether UPF0645 membrane protein C20H4.02 interacts with known components of the meiotic recombination machinery

    • Investigate if these interactions are temperature-dependent

This approach could help elucidate whether membrane dynamics, potentially involving UPF0645 membrane protein C20H4.02, contribute to the observed temperature sensitivity of meiotic recombination in S. pombe .

What techniques are recommended for studying membrane localization of UPF0645 protein C20H4.02?

Understanding the precise subcellular localization of UPF0645 membrane protein C20H4.02 is crucial for elucidating its function. Several complementary approaches are recommended:

TechniqueResolutionAdvantagesBest Application
Immunofluorescence microscopy200-300 nmWorks with endogenous proteinInitial localization
Live-cell fluorescence imaging200-300 nmDynamics in living cellsProtein trafficking
Super-resolution microscopy20-100 nmHigher resolution detailsPrecise localization
Electron microscopy0.1-5 nmUltrastructural contextMembrane integration
Membrane fractionationN/A (biochemical)Quantitative distributionMembrane domain mapping
Proximity labeling (BioID/APEX)VariableIdentifies neighboring proteinsMicroenvironment mapping

For comprehensive analysis, a multi-technique approach is recommended:

  • Initial screening with fluorescence microscopy using GFP-tagged UPF0645 protein C20H4.02 or specific antibodies

  • Biochemical fractionation to confirm membrane association and determine which cellular membranes contain the protein

  • Higher-resolution imaging for detailed localization, especially in relation to other cellular structures

  • Co-localization studies with markers of different cellular compartments (ER, Golgi, plasma membrane, etc.)

When using fluorescent protein tags, both N- and C-terminal fusions should be tested, as tag position can affect membrane protein trafficking and function. The hydrophobic C-terminal region of UPF0645 membrane protein C20H4.02 suggests it may span cellular membranes, making topology studies (determining which domains face which cellular compartments) particularly informative.

How can researchers resolve contradictory findings in UPF0645 membrane protein C20H4.02 studies?

Contradictory findings are common in research on poorly characterized proteins like UPF0645 membrane protein C20H4.02. To resolve such contradictions, researchers should employ a systematic approach:

  • Methodological reconciliation:

    • Compare experimental conditions (temperature, buffers, detergents)

    • Assess protein constructs (full-length vs. truncated, tag position)

    • Evaluate assay sensitivities and dynamic ranges

  • Biological context differences:

    • Cell type or strain variations (lab strains may have accumulated mutations)

    • Growth conditions and cell cycle stage

    • Environmental stressors that might alter protein function

  • Technical validation framework:

Contradiction TypeInvestigation ApproachResolution Strategy
Localization discrepanciesMultiple imaging techniquesDetermine if differences are condition-dependent
Functional inconsistenciesVaried assay conditionsIdentify parameters affecting function
Interaction partner disagreementsOrthogonal interaction methodsEstablish interaction dynamics
Expression level variationsQuantitative analysis across conditionsMap regulatory influences

Research on meiotic recombination in S. pombe has shown that temperature significantly affects recombination outcomes , suggesting that experimental temperature could be a critical factor in resolving contradictory findings. Similar temperature-dependent effects might influence UPF0645 membrane protein C20H4.02 function, localization, or interactions.

What statistical approaches are most appropriate for analyzing UPF0645 membrane protein C20H4.02 functional data?

Selecting appropriate statistical methods is crucial for robust analysis of functional data related to UPF0645 membrane protein C20H4.02. The optimal approach depends on the experimental design and data characteristics:

Data TypeRecommended Statistical MethodsAssumptionsSample Size Recommendations
Activity measurementst-test, ANOVANormal distributionMinimum n=5 biological replicates
Binding kineticsNon-linear regressionModel-specificMultiple concentrations, 3+ replicates
Localization quantificationChi-square testIndependent observations>100 cells across 3+ experiments
Temperature-dependent effectsTwo-way ANOVAVariance homogeneityIncreased n with temperature points
Non-normally distributed dataNon-parametric testsNo normality assumption10% more samples than parametric tests

For membrane protein studies specifically:

  • Account for batch effects: Expression and purification of membrane proteins often show significant batch-to-batch variation. Mixed-effects models can help address this.

  • Temperature considerations: When analyzing temperature-dependent effects (as might be relevant based on S. pombe meiotic recombination studies ), ensure balanced experimental design across temperature points and consider temperature as a continuous rather than categorical variable when appropriate.

  • Multivariate approaches: When examining multiple parameters simultaneously (e.g., activity under various temperature and pH combinations), response surface methodology can help identify optimal conditions and interactions between variables.

  • Power analysis: Conduct a priori power analysis to determine adequate sample sizes, especially important when working with challenging membrane proteins where experiments may be resource-intensive.

How should researchers design experiments to investigate the function of UPF0645 membrane protein C20H4.02?

Given the limited functional characterization of UPF0645 membrane protein C20H4.02, a systematic experimental approach is needed to elucidate its biological role:

  • Computational function prediction:

    • Analyze sequence conservation across species

    • Identify potential functional domains or motifs

    • Generate structural models to predict active sites or binding interfaces

  • Gene disruption studies:

    • Create knockout/knockdown strains

    • Phenotypic analysis under various conditions (including temperature ranges)

    • High-throughput screens to identify conditions where the protein becomes essential

  • Protein-protein interaction network:

    • Identify binding partners through AP-MS, Y2H, or BioID approaches

    • Validate key interactions through multiple methods

    • Map the protein into known cellular pathways

  • Localization and dynamics:

    • Determine subcellular localization under various conditions

    • Assess protein mobility and turnover rates

    • Investigate changes in response to cellular stresses

  • Function-specific assays based on predictions:

Predicted FunctionExperimental ApproachReadoutControls
Membrane organizationLipid organization assaysFluidity, domain formationKnown membrane organizers
Stress responseGrowth under various stressorsSurvival, growth rateKnown stress response proteins
Meiotic process involvementSporulation efficiencySpore formation, viabilityKnown meiotic proteins
Signaling rolePhosphorylation state analysisPTM changesKnown signaling components
Transport functionSubstrate flux assaysMovement across membranesCharacterized transporters

Given the temperature sensitivity observed in S. pombe meiotic recombination , testing protein function across a temperature gradient (16-33°C) might reveal condition-dependent roles that would be missed at standard laboratory temperatures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.