Recombinant Schizosaccharomyces pombe UPF0742 protein C1348.03 (SPBC1348.03)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Schizosaccharomyces pombe UPF0742 protein C1348.03 (SPBC1348.03) is a protein of unknown function within the fission yeast Schizosaccharomyces pombe . It is also referred to as ftm6 protein . This protein is encoded by the SPBC1348.03 gene and is a full-length protein consisting of 146 amino acids .

Protein Details

The UPF0742 protein C1348.03 has a molecular weight of approximately 16.7 kDa and is a transmembrane protein . The amino acid sequence of the protein is :
MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLAVKLLIYLLYCWYIYSEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQVIILFSIEKVTRSESKNHSYSKTDISDLHQGYNNPPSRFISQ. It is expressed in an in vitro E.coli expression system and tagged with an N-terminal 10xHis-tag for purification purposes .

Genomic Context

Schizosaccharomyces pombe is a unicellular eukaryote with a genome size of approximately 12.5 Mb, containing around 5,000 genes . The genome was fully sequenced in 2002, making it the sixth eukaryote to be sequenced . S. pombe is a valuable model organism for studying fundamental cellular processes such as cell division, DNA repair, and stress responses .

Protein Interactions

UPF0742 protein C1348.03 (SPBC1348.03) interacts with several predicted functional partners :

  • UPF0494 membrane protein C1348.01 (SPBC1348.01)

  • UPF0494 membrane protein SPAC212.01c (SPAC212.01c)

  • UPF0742 protein SPAC750.04c (ftm3)

  • Uncharacterized transporter SPAC750.02c (SPAC750.02c)

  • UPF0768 protein PB2B2.18 (SPBPB2B2.18)

  • UPF0742 protein PB2B2.17c (ftm7)

  • Uncharacterized protein C212.02 (SPAC212.02)

  • UPF0494 membrane protein C750.06c (SPAC750.06c)

  • Uncharacterized methyltransferase C750.03c (SPAC750.03c)

  • Uncharacterized transporter C1348.05 (SPBC1348.05)

These interactions suggest that UPF0742 protein C1348.03 may be involved in complex cellular processes, possibly related to transport or protein modification .

Expression and Purification

Schizosaccharomyces pombe is used as a host for the expression and purification of eukaryotic proteins . It offers post-translational modifications that are critical for the structure and function of eukaryotic proteins . The glutathione S-transferase (GST) is used as a protein purification tag in this system, allowing for rapid and high-yield production of proteins .

Proteolytic Degradation

A challenge in producing heterologous proteins in Schizosaccharomyces pombe is the proteolytic degradation of recombinant gene products by host-specific proteases . Researchers have constructed protease-deficient strains to address this issue, which helps in the effective production and purification of proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SPBC1348.03; UPF0742 protein C1348.03
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
SPBC1348.03
Target Protein Sequence
MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLAVKLLIYLLYCWYIYS EVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQVIILFSIEKVTRSESK NHSYSKTDISDLHQGYNNPPSRFISQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0742 family
Subcellular Location
Cytoplasm. Nucleus membrane; Single-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant SPBC1348.03 protein?

Several expression systems have been validated for recombinant SPBC1348.03 production, each with distinct advantages:

  • E. coli expression system: Most commonly employed, typically using BL21(DE3) or Rosetta strains with an N-terminal His-tag for purification. This system yields high protein quantities but may lack eukaryotic post-translational modifications .

  • Mammalian cell expression: Produces protein with potentially more relevant post-translational modifications, though with lower yields compared to prokaryotic systems .

  • Yeast expression system: Offers a more native-like environment with appropriate eukaryotic processing machinery, potentially preserving functional characteristics .

Expression optimization typically involves:

  • Temperature optimization (16-25°C during induction phase)

  • Induction parameters (0.1-1.0 mM IPTG for E. coli)

  • Codon optimization for the expression host

  • Buffer composition during cell lysis and purification

For challenging expressions, fusion partners such as SUMO, MBP, or GST can enhance solubility while maintaining a cleavable linker for tag removal after purification.

What are the optimal purification and storage conditions for recombinant SPBC1348.03?

Efficient purification of recombinant SPBC1348.03 follows a validated workflow with specific optimizations:

Purification StepRecommended ConditionsNotes
Affinity ChromatographyNi-NTA or Co-NTA with 20-250 mM imidazole gradientHis-tagged protein typically achieves >90% purity in single step
Buffer OptimizationTris-based buffer (pH 8.0) with 6% trehaloseTrehalose acts as a stabilizing agent
Storage50% glycerol at -20°C/-80°C (long-term)
4°C for up to one week (working aliquots)
Avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLAdd 5-50% glycerol for stability

SDS-PAGE analysis typically shows >85-90% purity after optimized purification . For enhanced stability during storage, dividing the purified protein into single-use aliquots prevents protein degradation from repeated freeze-thaw cycles, which significantly reduces activity and stability .

How can SPBC1348.03 be effectively tagged for subcellular localization studies?

Investigating the subcellular localization of SPBC1348.03 requires careful consideration of tagging strategies to avoid disrupting protein function:

  • Endogenous tagging: The preferred approach involves C-terminal or N-terminal fluorescent protein fusion at the genomic locus using homologous recombination. GFP and mCherry tags allow for visualization in living cells while maintaining native expression levels .

  • Tag positioning considerations:

    • C-terminal tagging is generally preferred unless C-terminal domains are critical for function

    • Flexible linkers (such as GSGSGS) between the protein and tag minimize functional interference

    • Validation of tagged protein functionality through complementation assays is essential

  • Imaging optimization:

    • For low-abundance proteins, techniques like SunTag or signal amplification can enhance detection

    • Co-imaging with organelle markers enables precise localization determination

    • Time-lapse imaging can reveal dynamic localization changes under different conditions

S. pombe-specific imaging considerations include its rod-shaped morphology and relatively small cellular compartments, requiring optimized microscopy settings. The fluorescent tagging approaches used in the studies of mating phenotypes in S. pombe provide valuable methodological insights applicable to SPBC1348.03 localization studies .

What genetic approaches are most effective for studying SPBC1348.03 function in S. pombe?

Multiple genetic manipulation strategies can elucidate SPBC1348.03 function:

  • Gene deletion/disruption: Creating ΔSPBC1348.03 strains using homologous recombination with antibiotic resistance markers or CRISPR-Cas9 . This approach reveals phenotypes associated with complete loss of function.

  • Conditional expression systems:

    • The optimized urg1 promoter system allows rapid induction (within 30 minutes)

    • Traditional nmt1 promoter system requires 14-20 hours for full induction

    • These approaches enable controlled expression for studying dosage-dependent effects

  • Point mutation strategies:

    • Site-directed mutagenesis targeting conserved residues

    • Introduction of dominant-negative mutations similar to the rad24-E185K approach used in other S. pombe studies

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis to identify functionally related genes

    • Epistasis analysis with known pathway components

When designing genetic studies, consider potential functional redundancy with homologous proteins in S. pombe (SPBPB2B2.15, SPAC977.05c) , which may mask phenotypes in single gene deletions. Natural isolates with different genetic backgrounds can provide additional insights into the protein's function across varying contexts .

What approaches can identify protein-protein interactions involving SPBC1348.03?

Several complementary methods can uncover the interactome of SPBC1348.03:

  • Immunoprecipitation-mass spectrometry (IP-MS): The gold standard approach that has been successfully applied to S. pombe transcription factors, identifying stable protein complexes for over a quarter of the studied proteins . This technique involves:

    • Tagging SPBC1348.03 with epitopes suitable for IP (FLAG, HA, etc.)

    • Crosslinking to capture transient interactions if necessary

    • Stringent controls to filter out non-specific interactions

  • Proximity-based methods:

    • BioID/TurboID: Fusion of biotin ligase to SPBC1348.03 to biotinylate proximal proteins

    • APEX2: Peroxidase-based proximity labeling for capturing interactions in specific subcellular compartments

  • Direct interaction validation:

    • Yeast two-hybrid (Y2H) screening for binary interactions

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in vivo

    • Co-immunoprecipitation for confirming specific interactions

  • Computational prediction:

    • Homology-based prediction using known interactions of homologs

    • Co-evolution analysis to identify proteins that have evolved in tandem

The comprehensive approach used to map transcription factor interactions in S. pombe provides an excellent methodological framework that could be adapted specifically for SPBC1348.03 .

How can structural studies of SPBC1348.03 be approached given limited prior characterization?

Structural characterization of SPBC1348.03 requires a multi-faceted approach given its limited prior characterization:

  • Computational structure prediction:

    • AlphaFold2/RoseTTAFold for ab initio structure prediction

    • Molecular dynamics simulations to explore conformational dynamics

    • Identification of conserved structural motifs through comparative analysis

  • Experimental structure determination:

    • X-ray crystallography, requiring optimization of:

      • Protein constructs (full-length vs. domains)

      • Crystallization conditions screening

      • Cryoprotection and data collection parameters

    • NMR spectroscopy for smaller domains or the full protein

    • Cryo-EM for larger complexes if SPBC1348.03 participates in multiprotein assemblies

  • Hybrid approaches:

    • Limited proteolysis to identify stable domains

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map flexible regions

    • Cross-linking mass spectrometry (XL-MS) to characterize protein topology

  • Functional validation:

    • Structure-guided mutagenesis targeting predicted functional sites

    • Domain deletion/swapping experiments to confirm structural predictions

A systematic approach combining computational predictions with targeted experimental validation offers the most efficient path toward structural characterization, especially for previously uncharacterized proteins like SPBC1348.03.

How can systems biology approaches integrate SPBC1348.03 into broader S. pombe cellular networks?

Incorporating SPBC1348.03 into comprehensive cellular networks requires sophisticated systems biology strategies:

  • Multi-omics data integration:

    • Transcriptomics: RNA-seq following SPBC1348.03 perturbation

    • Proteomics: Global protein abundance changes upon deletion/overexpression

    • Metabolomics: Metabolic shifts associated with SPBC1348.03 function

    • Integration frameworks to synthesize heterogeneous data types

  • Network reconstruction approaches:

    • Bayesian network inference for causal relationship modeling

    • Rule-based modeling that explicitly states assumptions about functional interactions

    • Formal visualization methods that capture network complexity (as discussed by Vértesy)

  • Perturbation-response analysis:

    • Systematic genetic perturbations (deletion, overexpression)

    • Environmental perturbations (nutrient limitation, stress conditions)

    • Measurement of system-wide responses to infer network connections

  • Comparative systems biology:

    • Network comparison across fungal species to identify conserved modules

    • Evolutionary analysis of network architecture involving SPBC1348.03 homologs

As noted in the methodological discussions by Vértesy, successful systems approaches require "data fusion of various omics sources: localization, viability, gene expression, steady state protein counts, interactions from various databases" . This integrated approach is essential for positioning SPBC1348.03 within the larger functional landscape of S. pombe.

How can contradictions in experimental data about SPBC1348.03 be systematically resolved?

When faced with conflicting experimental results regarding SPBC1348.03, researchers should implement a structured approach to resolution:

  • Systematic reproduction with controlled variables:

    • Standardize experimental conditions across laboratories

    • Document all methodological details, including media composition, strain background, and growth conditions

    • Implement blinded experimental design and analysis to minimize bias

  • Technical diversity:

    • Apply orthogonal techniques to address the same question

    • Quantify reliability through statistical replication

    • Assess technique-specific artifacts through control experiments

  • Strain validation:

    • Sequence verification of SPBC1348.03 in experimental strains

    • Consider natural variation in S. pombe isolates, which despite limited genetic diversity can exhibit significant phenotypic differences

    • Generate isogenic strains for comparative studies

  • Computational reconciliation:

    • Develop models that accommodate apparently contradictory data

    • Identify hidden variables that explain discrepancies

    • Implement formal data fusion approaches as discussed in the Vértesy thesis

The challenge of resolving contradictions is well-articulated in systems biology literature, where "literature sources are fragmented, sometimes even self-contradicting" and "resolving the contradictions and maintaining consistency with all demonstrated facts was a hard task" . Systematic documentation of both positive and negative results is crucial for building a coherent understanding of SPBC1348.03 function.

What are the considerations for CRISPR-Cas9 targeting of SPBC1348.03 in S. pombe?

Implementing CRISPR-Cas9 for genetic manipulation of SPBC1348.03 requires S. pombe-specific optimizations:

  • Guide RNA design considerations:

    • Target specificity analysis to avoid off-target effects on homologous genes like SPBPB2B2.15 and SPAC977.05c

    • PAM site availability within coding regions or regulatory elements

    • Strand bias and chromatin accessibility at the target site

  • Expression system optimization:

    • Promoter selection for Cas9 and gRNA expression:

      • Constitutive promoters (adh1) for continuous expression

      • Inducible systems (nmt1, urg1) for controlled activation

    • The urg1 system allows rapid induction (within 30 minutes) compared to nmt1 (14-20 hours)

  • Delivery and transformation protocols:

    • Optimized cell wall digestion using zymolyase or novozyme

    • Electroporation parameters (voltage, capacitance, resistance)

    • Recovery media composition for maximizing transformation efficiency

  • Repair template design:

    • Homology arms length (minimum 500bp recommended)

    • Silent mutations in PAM or seed region to prevent re-cutting

    • Inclusion of selection markers for efficient screening

  • Screening strategies:

    • Colony PCR protocols optimized for S. pombe

    • Restriction digest analysis for detecting successful edits

    • Sequencing confirmation of precise modifications

The optimized experimental design methods described for genetic manipulation in S. pombe provide valuable methodological guidance for CRISPR-Cas9 implementation .

How can evolutionary analysis of SPBC1348.03 inform functional predictions?

Evolutionary analysis offers powerful insights into potential functions of SPBC1348.03:

  • Comparative genomics approaches:

    • Multiple sequence alignment across fungal homologs to identify conserved residues

    • Evolutionary rate analysis to detect functionally constrained regions

    • Domain architecture comparison across species

  • Phylogenetic profiling:

    • Co-occurrence patterns with functionally related proteins

    • Gene neighborhood conservation in different fungal genomes

    • Detection of correlated evolutionary rates with interaction partners

  • Selection pressure analysis:

    • dN/dS ratio calculation to identify regions under purifying or positive selection

    • Identification of episodic selection during fungal evolution

    • Lineage-specific acceleration or constraint patterns

  • Structural evolution mapping:

    • Mapping conserved residues onto predicted structural models

    • Identification of conserved surface patches likely involved in interactions

    • Evolutionary trace methods to detect functionally important positions

The presence of multiple homologs in both S. pombe and S. cerevisiae suggests potential functional diversification following gene duplication events . Detailed analysis of sequence conservation patterns between these homologs can provide insights into shared ancestral functions versus specialized roles that evolved after duplication.

What methodological approaches can determine if SPBC1348.03 forms part of transcriptional regulatory networks?

Given the recent comprehensive characterization of transcription factors in S. pombe , several approaches can investigate potential roles of SPBC1348.03 in transcriptional regulation:

  • Chromatin association studies:

    • Chromatin immunoprecipitation sequencing (ChIP-seq) using tagged SPBC1348.03

    • CUT&RUN or CUT&Tag for higher resolution mapping with lower background

    • Chromatin fractionation followed by Western blotting to detect chromatin association

  • Transcriptional impact analysis:

    • RNA-seq following SPBC1348.03 deletion or overexpression

    • NET-seq to detect nascent transcription changes

    • Single-cell transcriptomics to capture cell-to-cell variability in responses

  • Interaction with known transcriptional machinery:

    • Co-immunoprecipitation with RNA polymerase components

    • Proximity labeling near transcriptionally active regions

    • Fluorescence co-localization with transcription factories

  • Binding motif discovery:

    • De novo motif finding from ChIP-seq data if DNA association is detected

    • Comparison with the 38 transcription factor motifs recently identified in S. pombe

    • In vitro binding assays like EMSA or protein binding microarrays

The recent comprehensive atlas of physical interactions for 89 S. pombe transcription factors provides an excellent methodological framework and reference dataset . This study identified DNA-binding sites across 2,027 unique genomic regions and revealed motifs for 38 transcription factors, creating a valuable comparative resource for investigating potential transcriptional regulatory roles of SPBC1348.03.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.