Recombinant Schizosaccharomyces pombe UPF0742 protein C1348.03 (SPBC1348.03) is a protein of unknown function within the fission yeast Schizosaccharomyces pombe . It is also referred to as ftm6 protein . This protein is encoded by the SPBC1348.03 gene and is a full-length protein consisting of 146 amino acids .
The UPF0742 protein C1348.03 has a molecular weight of approximately 16.7 kDa and is a transmembrane protein . The amino acid sequence of the protein is :
MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLAVKLLIYLLYCWYIYSEVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQVIILFSIEKVTRSESKNHSYSKTDISDLHQGYNNPPSRFISQ. It is expressed in an in vitro E.coli expression system and tagged with an N-terminal 10xHis-tag for purification purposes .
Schizosaccharomyces pombe is a unicellular eukaryote with a genome size of approximately 12.5 Mb, containing around 5,000 genes . The genome was fully sequenced in 2002, making it the sixth eukaryote to be sequenced . S. pombe is a valuable model organism for studying fundamental cellular processes such as cell division, DNA repair, and stress responses .
UPF0742 protein C1348.03 (SPBC1348.03) interacts with several predicted functional partners :
UPF0494 membrane protein C1348.01 (SPBC1348.01)
UPF0494 membrane protein SPAC212.01c (SPAC212.01c)
UPF0742 protein SPAC750.04c (ftm3)
Uncharacterized transporter SPAC750.02c (SPAC750.02c)
UPF0768 protein PB2B2.18 (SPBPB2B2.18)
UPF0742 protein PB2B2.17c (ftm7)
Uncharacterized protein C212.02 (SPAC212.02)
UPF0494 membrane protein C750.06c (SPAC750.06c)
Uncharacterized methyltransferase C750.03c (SPAC750.03c)
Uncharacterized transporter C1348.05 (SPBC1348.05)
These interactions suggest that UPF0742 protein C1348.03 may be involved in complex cellular processes, possibly related to transport or protein modification .
Schizosaccharomyces pombe is used as a host for the expression and purification of eukaryotic proteins . It offers post-translational modifications that are critical for the structure and function of eukaryotic proteins . The glutathione S-transferase (GST) is used as a protein purification tag in this system, allowing for rapid and high-yield production of proteins .
A challenge in producing heterologous proteins in Schizosaccharomyces pombe is the proteolytic degradation of recombinant gene products by host-specific proteases . Researchers have constructed protease-deficient strains to address this issue, which helps in the effective production and purification of proteins .
KEGG: spo:SPBC1348.03
STRING: 4896.SPBC1348.03.1
Several expression systems have been validated for recombinant SPBC1348.03 production, each with distinct advantages:
E. coli expression system: Most commonly employed, typically using BL21(DE3) or Rosetta strains with an N-terminal His-tag for purification. This system yields high protein quantities but may lack eukaryotic post-translational modifications .
Mammalian cell expression: Produces protein with potentially more relevant post-translational modifications, though with lower yields compared to prokaryotic systems .
Yeast expression system: Offers a more native-like environment with appropriate eukaryotic processing machinery, potentially preserving functional characteristics .
Expression optimization typically involves:
Temperature optimization (16-25°C during induction phase)
Induction parameters (0.1-1.0 mM IPTG for E. coli)
Codon optimization for the expression host
Buffer composition during cell lysis and purification
For challenging expressions, fusion partners such as SUMO, MBP, or GST can enhance solubility while maintaining a cleavable linker for tag removal after purification.
Efficient purification of recombinant SPBC1348.03 follows a validated workflow with specific optimizations:
| Purification Step | Recommended Conditions | Notes |
|---|---|---|
| Affinity Chromatography | Ni-NTA or Co-NTA with 20-250 mM imidazole gradient | His-tagged protein typically achieves >90% purity in single step |
| Buffer Optimization | Tris-based buffer (pH 8.0) with 6% trehalose | Trehalose acts as a stabilizing agent |
| Storage | 50% glycerol at -20°C/-80°C (long-term) 4°C for up to one week (working aliquots) | Avoid repeated freeze-thaw cycles |
| Reconstitution | Deionized sterile water to 0.1-1.0 mg/mL | Add 5-50% glycerol for stability |
SDS-PAGE analysis typically shows >85-90% purity after optimized purification . For enhanced stability during storage, dividing the purified protein into single-use aliquots prevents protein degradation from repeated freeze-thaw cycles, which significantly reduces activity and stability .
Investigating the subcellular localization of SPBC1348.03 requires careful consideration of tagging strategies to avoid disrupting protein function:
Endogenous tagging: The preferred approach involves C-terminal or N-terminal fluorescent protein fusion at the genomic locus using homologous recombination. GFP and mCherry tags allow for visualization in living cells while maintaining native expression levels .
Tag positioning considerations:
C-terminal tagging is generally preferred unless C-terminal domains are critical for function
Flexible linkers (such as GSGSGS) between the protein and tag minimize functional interference
Validation of tagged protein functionality through complementation assays is essential
Imaging optimization:
For low-abundance proteins, techniques like SunTag or signal amplification can enhance detection
Co-imaging with organelle markers enables precise localization determination
Time-lapse imaging can reveal dynamic localization changes under different conditions
S. pombe-specific imaging considerations include its rod-shaped morphology and relatively small cellular compartments, requiring optimized microscopy settings. The fluorescent tagging approaches used in the studies of mating phenotypes in S. pombe provide valuable methodological insights applicable to SPBC1348.03 localization studies .
Multiple genetic manipulation strategies can elucidate SPBC1348.03 function:
Gene deletion/disruption: Creating ΔSPBC1348.03 strains using homologous recombination with antibiotic resistance markers or CRISPR-Cas9 . This approach reveals phenotypes associated with complete loss of function.
Conditional expression systems:
Point mutation strategies:
Genetic interaction mapping:
Synthetic genetic array (SGA) analysis to identify functionally related genes
Epistasis analysis with known pathway components
When designing genetic studies, consider potential functional redundancy with homologous proteins in S. pombe (SPBPB2B2.15, SPAC977.05c) , which may mask phenotypes in single gene deletions. Natural isolates with different genetic backgrounds can provide additional insights into the protein's function across varying contexts .
Several complementary methods can uncover the interactome of SPBC1348.03:
Immunoprecipitation-mass spectrometry (IP-MS): The gold standard approach that has been successfully applied to S. pombe transcription factors, identifying stable protein complexes for over a quarter of the studied proteins . This technique involves:
Tagging SPBC1348.03 with epitopes suitable for IP (FLAG, HA, etc.)
Crosslinking to capture transient interactions if necessary
Stringent controls to filter out non-specific interactions
Proximity-based methods:
BioID/TurboID: Fusion of biotin ligase to SPBC1348.03 to biotinylate proximal proteins
APEX2: Peroxidase-based proximity labeling for capturing interactions in specific subcellular compartments
Direct interaction validation:
Yeast two-hybrid (Y2H) screening for binary interactions
Bimolecular fluorescence complementation (BiFC) for visualizing interactions in vivo
Co-immunoprecipitation for confirming specific interactions
Computational prediction:
Homology-based prediction using known interactions of homologs
Co-evolution analysis to identify proteins that have evolved in tandem
The comprehensive approach used to map transcription factor interactions in S. pombe provides an excellent methodological framework that could be adapted specifically for SPBC1348.03 .
Structural characterization of SPBC1348.03 requires a multi-faceted approach given its limited prior characterization:
Computational structure prediction:
AlphaFold2/RoseTTAFold for ab initio structure prediction
Molecular dynamics simulations to explore conformational dynamics
Identification of conserved structural motifs through comparative analysis
Experimental structure determination:
X-ray crystallography, requiring optimization of:
Protein constructs (full-length vs. domains)
Crystallization conditions screening
Cryoprotection and data collection parameters
NMR spectroscopy for smaller domains or the full protein
Cryo-EM for larger complexes if SPBC1348.03 participates in multiprotein assemblies
Hybrid approaches:
Limited proteolysis to identify stable domains
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map flexible regions
Cross-linking mass spectrometry (XL-MS) to characterize protein topology
Functional validation:
Structure-guided mutagenesis targeting predicted functional sites
Domain deletion/swapping experiments to confirm structural predictions
A systematic approach combining computational predictions with targeted experimental validation offers the most efficient path toward structural characterization, especially for previously uncharacterized proteins like SPBC1348.03.
Incorporating SPBC1348.03 into comprehensive cellular networks requires sophisticated systems biology strategies:
Multi-omics data integration:
Network reconstruction approaches:
Perturbation-response analysis:
Systematic genetic perturbations (deletion, overexpression)
Environmental perturbations (nutrient limitation, stress conditions)
Measurement of system-wide responses to infer network connections
Comparative systems biology:
Network comparison across fungal species to identify conserved modules
Evolutionary analysis of network architecture involving SPBC1348.03 homologs
As noted in the methodological discussions by Vértesy, successful systems approaches require "data fusion of various omics sources: localization, viability, gene expression, steady state protein counts, interactions from various databases" . This integrated approach is essential for positioning SPBC1348.03 within the larger functional landscape of S. pombe.
When faced with conflicting experimental results regarding SPBC1348.03, researchers should implement a structured approach to resolution:
Systematic reproduction with controlled variables:
Standardize experimental conditions across laboratories
Document all methodological details, including media composition, strain background, and growth conditions
Implement blinded experimental design and analysis to minimize bias
Technical diversity:
Apply orthogonal techniques to address the same question
Quantify reliability through statistical replication
Assess technique-specific artifacts through control experiments
Strain validation:
Computational reconciliation:
The challenge of resolving contradictions is well-articulated in systems biology literature, where "literature sources are fragmented, sometimes even self-contradicting" and "resolving the contradictions and maintaining consistency with all demonstrated facts was a hard task" . Systematic documentation of both positive and negative results is crucial for building a coherent understanding of SPBC1348.03 function.
Implementing CRISPR-Cas9 for genetic manipulation of SPBC1348.03 requires S. pombe-specific optimizations:
Guide RNA design considerations:
Expression system optimization:
Delivery and transformation protocols:
Optimized cell wall digestion using zymolyase or novozyme
Electroporation parameters (voltage, capacitance, resistance)
Recovery media composition for maximizing transformation efficiency
Repair template design:
Homology arms length (minimum 500bp recommended)
Silent mutations in PAM or seed region to prevent re-cutting
Inclusion of selection markers for efficient screening
Screening strategies:
Colony PCR protocols optimized for S. pombe
Restriction digest analysis for detecting successful edits
Sequencing confirmation of precise modifications
The optimized experimental design methods described for genetic manipulation in S. pombe provide valuable methodological guidance for CRISPR-Cas9 implementation .
Evolutionary analysis offers powerful insights into potential functions of SPBC1348.03:
Comparative genomics approaches:
Multiple sequence alignment across fungal homologs to identify conserved residues
Evolutionary rate analysis to detect functionally constrained regions
Domain architecture comparison across species
Phylogenetic profiling:
Co-occurrence patterns with functionally related proteins
Gene neighborhood conservation in different fungal genomes
Detection of correlated evolutionary rates with interaction partners
Selection pressure analysis:
dN/dS ratio calculation to identify regions under purifying or positive selection
Identification of episodic selection during fungal evolution
Lineage-specific acceleration or constraint patterns
Structural evolution mapping:
Mapping conserved residues onto predicted structural models
Identification of conserved surface patches likely involved in interactions
Evolutionary trace methods to detect functionally important positions
The presence of multiple homologs in both S. pombe and S. cerevisiae suggests potential functional diversification following gene duplication events . Detailed analysis of sequence conservation patterns between these homologs can provide insights into shared ancestral functions versus specialized roles that evolved after duplication.
Given the recent comprehensive characterization of transcription factors in S. pombe , several approaches can investigate potential roles of SPBC1348.03 in transcriptional regulation:
Chromatin association studies:
Chromatin immunoprecipitation sequencing (ChIP-seq) using tagged SPBC1348.03
CUT&RUN or CUT&Tag for higher resolution mapping with lower background
Chromatin fractionation followed by Western blotting to detect chromatin association
Transcriptional impact analysis:
RNA-seq following SPBC1348.03 deletion or overexpression
NET-seq to detect nascent transcription changes
Single-cell transcriptomics to capture cell-to-cell variability in responses
Interaction with known transcriptional machinery:
Co-immunoprecipitation with RNA polymerase components
Proximity labeling near transcriptionally active regions
Fluorescence co-localization with transcription factories
Binding motif discovery:
The recent comprehensive atlas of physical interactions for 89 S. pombe transcription factors provides an excellent methodological framework and reference dataset . This study identified DNA-binding sites across 2,027 unique genomic regions and revealed motifs for 38 transcription factors, creating a valuable comparative resource for investigating potential transcriptional regulatory roles of SPBC1348.03.