Recombinant Schizosaccharomyces pombe UPF0742 protein C750.04c/C977.02 (SPAC750.04c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its inclusion during production.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Target Names
SPAC750.04c
Target Protein Sequence
MALLKKINTQVNRIMKNSSLVQNICFDRVPLFIPRLSLTVKYCLAVKLLIYLLYCWYIYS EVPSASSKFRSFTFGCVVVYHNKFFPRFIRTHSINSIRTFSKFQVIILFSIEKVTRSESK NHSYSKTDISDLHQGYNNPPSRFISR
Uniprot No.

Q&A

What is Schizosaccharomyces pombe UPF0742 protein C750.04c/C977.02 (SPAC750.04c)?

SPAC750.04c is a protein from the fission yeast Schizosaccharomyces pombe that belongs to the UPF0742 protein family. It is a relatively small protein consisting of 146 amino acids and is available commercially as a recombinant protein with a histidine tag for research purposes . The protein has been identified as a Swi6-bound protein, suggesting potential involvement in heterochromatin formation or regulation in S. pombe . This association with heterochromatin structures indicates possible roles in gene expression regulation and chromosome stability maintenance.

What is known about the gene expression patterns of SPAC750.04c?

According to available research data, SPAC750.04c shows significant binding to heterochromatin protein Swi6 with a binding value of 2.358, as determined through chromatin immunoprecipitation experiments . This binding pattern places it among other strongly Swi6-associated genes in S. pombe. The gene's expression may be affected in aneuploid conditions, though specific expression changes require further investigation. Researchers should note that genes bound by Swi6 often show characteristic expression patterns in response to environmental stressors and cell cycle changes.

How does SPAC750.04c relate to other Swi6-bound proteins in S. pombe?

SPAC750.04c exists within a network of Swi6-bound proteins in S. pombe. Based on binding intensity data, it ranks among the top Swi6-associated proteins with a binding value of 2.358 . For comparison, other strongly Swi6-bound proteins include:

ProteinSwi6 Binding ValueRelative Position
SPBC1348.032.876Higher binding
SPBPB2B2.06c2.751Higher binding
SPAC977.022.732Higher binding
SPAC977.042.524Higher binding
SPAC750.04c2.358Subject protein
SPAC750.02c2.229Lower binding
SPBPB2B2.07c2.004Lower binding

This positioning within the Swi6-binding spectrum suggests SPAC750.04c plays an important role in heterochromatin-associated processes in fission yeast .

What are the optimal conditions for recombinant expression of SPAC750.04c?

For optimal recombinant expression of SPAC750.04c, an Escherichia coli expression system is recommended. Based on research with similar proteins, using an E. coli strain deficient in rhamnose transport and rhamnose catabolism (such as E. coli ΔrhaΔlac) combined with a rhamnose promoter-based expression system offers precise regulation of protein production rates . This setup allows researchers to avoid saturation of the Sec-translocon capacity during secretory protein production.

The optimal expression parameters include:

  • Growth at 30°C with aerobic conditions (200 rpm shaking)

  • LB medium supplemented with appropriate antibiotics (kanamycin at 50 μg/ml)

  • Addition of 0.2% glucose to precultures to prevent background expression

  • Induction at A600 of approximately 0.5 with rhamnose

  • Testing various rhamnose concentrations (50-5000 μM) to determine optimal induction level for SPAC750.04c

For maximum yield, harvesting cells 4-6 hours post-induction is recommended, though specific timing should be optimized experimentally.

How should researchers approach signal peptide selection for optimal periplasmic expression of SPAC750.04c?

Signal peptide selection critically influences periplasmic expression efficiency of recombinant proteins like SPAC750.04c. Research indicates that a combinatorial screening approach testing multiple signal peptides at various production rates yields the best results . For SPAC750.04c, researchers should consider testing the following signal peptides:

Signal PeptideCharacteristicsRecommendations
DsbAStrong targeting to periplasmTest at low to medium induction levels
OmpAWell-characterized for various proteinsGood baseline option
PhoAEffective for disulfide-containing proteinsConsider if SPAC750.04c has disulfide bonds
HbpEffective for certain recombinant proteinsTest at various expression levels

The optimal combination of signal peptide and production rate should be determined experimentally for SPAC750.04c, as each protein responds differently to these variables . Researchers should create expression vectors containing SPAC750.04c with each signal peptide and test expression at multiple rhamnose concentrations (e.g., 0, 50, 100, 250, 500, and 5000 μM).

What purification strategies are most effective for recombinant SPAC750.04c?

For efficient purification of recombinant SPAC750.04c, a histidine-tagged version is commercially available and can be expressed in E. coli systems . Based on established protocols for similar proteins, the following purification strategy is recommended:

  • Express SPAC750.04c as a His-tagged fusion protein in E. coli using optimized conditions

  • Harvest cells and prepare lysate using appropriate buffer systems

  • Perform initial capture using immobilized metal affinity chromatography (IMAC)

  • Apply a secondary purification step using size exclusion chromatography

  • Verify purity using SDS-PAGE and Western blotting

  • Confirm protein identity using mass spectrometry

For specific applications requiring higher purity, additional chromatography steps may be necessary. Researchers should optimize buffer conditions based on the predicted isoelectric point and stability characteristics of SPAC750.04c.

How does SPAC750.04c contribute to heterochromatin organization in S. pombe?

SPAC750.04c has been identified as a Swi6-bound protein with a binding value of 2.358 , suggesting it plays a significant role in heterochromatin organization. Swi6 is the S. pombe homolog of heterochromatin protein 1 (HP1), a key factor in heterochromatin assembly and maintenance. Research indicates that proteins with strong Swi6 binding, like SPAC750.04c, often contribute to maintaining heterochromatin boundaries, silencing of embedded genes, or preventing illicit recombination within repetitive regions.

The strong association with Swi6 places SPAC750.04c among other important heterochromatin-associated factors. Researchers investigating SPAC750.04c should consider chromatin immunoprecipitation followed by sequencing (ChIP-seq) experiments to identify genomic regions where this protein localizes, as well as genetic interaction studies to understand its functional relationships with other heterochromatin components.

What is the relationship between SPAC750.04c and chromosomal stability in aneuploid conditions?

Research on partial aneuploids in S. pombe suggests that Swi6-bound proteins like SPAC750.04c may have altered distribution in cells with abnormal chromosome numbers . This redistribution could lead to changes in gene expression patterns and potentially impact chromosomal stability. The presence of SPAC750.04c in the dataset examining gene expression and Swi6 distribution in aneuploids indicates its potential involvement in the cellular response to aneuploidy.

For researchers investigating this relationship, the following approaches are recommended:

  • Compare SPAC750.04c localization patterns between euploid and aneuploid cells

  • Assess changes in genes regulated by SPAC750.04c in aneuploid conditions

  • Examine genetic interactions between SPAC750.04c and known chromosomal stability factors

  • Evaluate the impact of SPAC750.04c depletion or overexpression on aneuploid cell viability

These investigations would provide valuable insights into how heterochromatin-associated proteins like SPAC750.04c contribute to genome stability under conditions of chromosome imbalance.

How might post-translational modifications affect SPAC750.04c function?

While specific post-translational modifications (PTMs) of SPAC750.04c have not been directly reported in the provided search results, its association with heterochromatin suggests potential regulation by modifications common to chromatin-associated proteins. Many Swi6-associated proteins undergo phosphorylation, methylation, or SUMOylation that influence their localization and function within heterochromatin.

Researchers investigating PTMs of SPAC750.04c should consider:

  • Phosphoproteome analysis to identify potential phosphorylation sites

  • Mass spectrometry-based approaches to detect methylation, acetylation, or SUMOylation

  • Mutational analysis of predicted modification sites to assess functional consequences

  • Co-immunoprecipitation studies to identify potential modifying enzymes

Understanding the PTM landscape of SPAC750.04c would provide crucial insights into its regulation and function within heterochromatin structures.

How should researchers interpret SPAC750.04c binding patterns in genome-wide studies?

When analyzing SPAC750.04c binding patterns in genome-wide studies, researchers should consider its context as a Swi6-bound protein . The binding value of 2.358 indicates relatively strong association with heterochromatin regions. When interpreting ChIP-seq or similar data for SPAC750.04c, researchers should:

  • Compare binding patterns with known heterochromatin domains (centromeres, telomeres, mating-type region)

  • Assess co-localization with other Swi6-bound proteins to identify potential functional complexes

  • Examine binding strength variations across different genomic regions

  • Consider cell cycle-dependent changes in binding patterns

  • Evaluate how experimental conditions affect binding profiles

Data interpretation should acknowledge that Swi6-bound proteins often show characteristic distribution patterns, and changes in these patterns may indicate functional alterations in heterochromatin structure or composition.

What bioinformatic approaches are most appropriate for SPAC750.04c functional prediction?

For predicting SPAC750.04c functions using bioinformatic approaches, researchers should employ multiple complementary methods:

  • Sequence-based analyses:

    • Homology searches across species to identify conserved domains

    • Motif identification to predict functional sites

    • Secondary structure prediction to infer potential interaction surfaces

  • Network-based analyses:

    • Integration with protein-protein interaction data focusing on Swi6 networks

    • Co-expression analysis across different conditions

    • Genetic interaction profiles comparison with known heterochromatin factors

  • Comparative genomics:

    • Examining conservation patterns of SPAC750.04c across fungal species

    • Identifying synteny relationships that might suggest functional conservation

    • Analyzing evolutionary rates to identify functionally constrained regions

These approaches should be integrated to develop testable hypotheses about SPAC750.04c function within the context of heterochromatin regulation and maintenance.

How can researchers overcome low yield issues when expressing recombinant SPAC750.04c?

Low yields of recombinant SPAC750.04c can result from various factors. Based on research with similar proteins, the following troubleshooting approaches are recommended:

  • Optimize expression conditions:

    • Test different E. coli strains, particularly those optimized for heterologous protein expression

    • Evaluate multiple rhamnose concentrations (50-5000 μM) to find optimal induction level

    • Adjust growth temperature (25-30°C typically yields better results than 37°C for challenging proteins)

    • Consider using a rhamnose promoter-based system in a rhamnose transport-deficient background for precisely controlled expression

  • Improve protein targeting and solubility:

    • Test different signal peptides (DsbA, OmpA, PhoA, Hbp) for optimal periplasmic targeting

    • Add solubility-enhancing fusion tags (MBP, SUMO) if cytoplasmic expression is preferred

    • Optimize lysis and extraction buffers based on predicted protein properties

  • Address potential toxicity issues:

    • Use tightly controlled expression systems to prevent leaky expression

    • Consider co-expression with chaperones to aid proper folding

    • Implement auto-induction media for gradual protein production

These approaches have proven effective for improving yields of challenging recombinant proteins similar to SPAC750.04c .

What are common challenges in studying SPAC750.04c localization and how can they be addressed?

Studying the cellular localization of heterochromatin-associated proteins like SPAC750.04c presents several challenges. Based on research with similar proteins, researchers should consider:

  • Fixation artifacts:

    • Optimize fixation protocols to preserve native chromatin structure

    • Compare multiple fixation methods (formaldehyde, methanol) to ensure consistent results

    • Use live-cell imaging with fluorescent tags as complementary approach

  • Antibody specificity issues:

    • Validate antibodies using knockout/knockdown controls

    • Consider epitope-tagging strategies (HA, FLAG, GFP) for detection

    • Use multiple antibodies targeting different regions when possible

  • Detection sensitivity:

    • Implement signal amplification methods for low-abundance proteins

    • Use super-resolution microscopy for detailed localization studies

    • Consider ChIP-seq approaches for genome-wide localization analysis

  • Dynamic localization patterns:

    • Perform time-course experiments to capture temporal changes

    • Synchronize cells to examine cell cycle-dependent localization

    • Test various stress conditions that might affect heterochromatin distribution

These methodological considerations will help researchers obtain accurate and reproducible data on SPAC750.04c localization and dynamics.

What are promising approaches for elucidating SPAC750.04c function in heterochromatin regulation?

To further elucidate SPAC750.04c function in heterochromatin regulation, several promising research directions emerge:

  • Genetic interaction mapping:

    • Systematic deletion/overexpression in combination with known heterochromatin factors

    • Synthetic genetic array analysis to identify functional networks

    • CRISPR screening to identify genetic dependencies

  • Structural biology approaches:

    • Protein crystallography or cryo-EM to determine three-dimensional structure

    • NMR studies to examine protein dynamics and interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify interaction surfaces

  • Mechanistic biochemical studies:

    • In vitro reconstitution of SPAC750.04c-containing complexes

    • Activity assays to identify potential enzymatic functions

    • Single-molecule approaches to study dynamics of interactions

  • Systems-level analyses:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics) in SPAC750.04c mutants

    • Mathematical modeling of heterochromatin assembly incorporating SPAC750.04c

    • Comparative analysis across fungal species to identify conserved functions

These approaches would significantly advance our understanding of SPAC750.04c's role in heterochromatin biology and potentially reveal new principles of chromatin organization.

How might SPAC750.04c research contribute to broader understanding of chromosome stability mechanisms?

Research on SPAC750.04c has potential to enhance our understanding of chromosome stability mechanisms through several avenues:

  • Heterochromatin-mediated genome stability:

    • Elucidating how Swi6-bound proteins like SPAC750.04c contribute to centromere and telomere function

    • Understanding the role of heterochromatin in preventing illicit recombination

    • Investigating how heterochromatin composition affects replication timing and fidelity

  • Aneuploidy response mechanisms:

    • Determining how heterochromatin proteins respond to chromosome imbalances

    • Identifying compensatory mechanisms that maintain genome function in aneuploid states

    • Understanding how heterochromatin redistribution affects gene expression in aneuploids

  • Evolutionary consequences:

    • Comparing SPAC750.04c function across fungal species to identify conserved stability mechanisms

    • Investigating how heterochromatin proteins adapt to different genome architectures

    • Understanding the role of heterochromatin factors in speciation events

This research would bridge fundamental chromatin biology with applied aspects of genome stability, potentially revealing new therapeutic targets for conditions involving chromosome instability.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.