Recombinant Schizosaccharomyces pombe V-type ATPase assembly factor pkr1 (pkr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pkr1; SPBP23A10.02; V-type ATPase assembly factor pkr1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
pkr1
Target Protein Sequence
MSYWVELWESIFTPGVTPVLAKSAHVACGALVAVFLGLYIGTKSIHCLILFFLAICLWLS LTWFLVELAHARVNNDLQMSSQSANKNDDNSNNQNPSNNKEMSDKESDSATTTQTFSVPE ELLRARTTANNS
Uniprot No.

Target Background

Function
This protein functions within the endoplasmic reticulum alongside other V-type ATPase assembly factors to facilitate the efficient assembly of the V-type ATPase membrane sector V0.
Database Links
Protein Families
PKR1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the Pkr1 protein in Schizosaccharomyces pombe?

Pkr1 is an essential assembly factor for the vacuolar-type ATPase (V-ATPase) complex in fission yeast. It is encoded by the pkr1 gene and serves a critical role in the biogenesis of the V-ATPase membrane sector (V0). Pkr1 is localized to the endoplasmic reticulum (ER) membrane where it facilitates proper assembly of V-ATPase components . Unlike some other V-ATPase assembly factors, Pkr1 functions primarily in ensuring proper levels and stability of V-ATPase subunits, particularly the V0 subunit Vph1p, rather than being structurally incorporated into the final complex.

How does Pkr1 function differ between S. pombe and Saccharomyces cerevisiae?

While both organisms use Pkr1 as a V-ATPase assembly factor, there are distinct differences in function:

FeatureS. pombe Pkr1S. cerevisiae Pkr1
LocalizationER membraneER membrane
Primary functionV-ATPase assemblyV-ATPase assembly
Growth phenotype when deletedReduced growth under certain conditionsInability to grow on iron-limited medium
Effect on V-ATPase subunitsAffects stability of V0 componentsReduces levels of Vph1p due to increased turnover
Interaction with other assembly factorsWorks with other assembly factorsFunctions with Vma21p and other assembly factors

Unlike some assembly mutants, cells lacking Pkr1 can still assemble a functional V-ATPase that reaches the vacuolar membrane, albeit with reduced efficiency .

What are the optimal conditions for expressing recombinant S. pombe Pkr1 protein?

For successful expression of recombinant S. pombe Pkr1, researchers should consider:

  • Expression system: E. coli systems can be used, but yeast expression systems (particularly S. cerevisiae) often provide better results for proper folding of this membrane protein

  • Temperature: Lower expression temperatures (16-20°C) may improve yield of correctly folded protein

  • Induction conditions: For IPTG-inducible systems, lower concentrations (0.1-0.5 mM) can improve proper folding

  • Storage buffer: A Tris-based buffer with 50% glycerol has been shown to maintain stability

  • Storage temperature: -20°C for short-term, -80°C for extended storage

For membrane proteins like Pkr1, detergent selection is critical. Non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) at 0.03-0.05% can effectively solubilize Pkr1 while maintaining its native conformation.

How can researchers verify the functionality of recombinant Pkr1 protein?

Functional verification can be accomplished through several complementary approaches:

  • Complementation assays: Introduce recombinant Pkr1 into pkr1Δ cells and assess rescue of growth defects on iron-limited media

  • V-ATPase assembly assays: Monitor levels of Vph1p and other V-ATPase subunits in reconstituted systems

  • Protein-protein interaction studies: Use co-immunoprecipitation to verify interaction with other V-ATPase assembly factors like Vma21p

  • Vacuolar acidification assays: Measure the restoration of vacuolar acidification using pH-sensitive fluorescent dyes in complemented pkr1Δ cells

The most definitive test is to demonstrate that the recombinant protein restores proper V-ATPase assembly and function in pkr1Δ cells.

How does Pkr1 coordinate with other assembly factors in the ER during V-ATPase biogenesis?

Pkr1 functions as part of a complex network of assembly factors in the ER. Evidence suggests a hierarchical assembly process:

  • Pkr1 collaborates with Vma21p and potentially Voa1p in the early stages of V0 sector assembly

  • Assembly likely begins with association of Pkr1 with the proteolipid subunits (including Vma11p)

  • Vma6p is subsequently recruited to this initial complex

  • Vph1p incorporation represents the final step in V0 assembly

  • The fully assembled Pkr1/proteolipid/Vma6p/Vph1p complex is preferentially packaged into COPII-coated transport vesicles for ER export

Interestingly, overexpression of the V-ATPase assembly factor Vma21p can suppress growth and acidification defects of pkr1Δ cells, suggesting a degree of functional redundancy or compensation between these assembly factors .

What methodologies are most effective for studying Pkr1-mediated V-ATPase assembly in vivo?

Several sophisticated approaches can be employed:

  • Live-cell imaging with fluorescent protein fusions: Tagging Pkr1 and V-ATPase subunits with different fluorescent proteins allows real-time visualization of assembly dynamics

  • Pulse-chase experiments: These reveal the transient nature of Pkr1's interaction with V0 components and show that Pkr1/V0 dissociation occurs concomitantly with V0/V1 assembly

  • In vitro ER export assays: These can demonstrate preferential packaging of fully assembled V-ATPase complexes into COPII-coated transport vesicles

  • Conditional mutants: Using temperature-sensitive sec mutants to block ER export stabilizes the interaction between Pkr1 and V0, providing a system to study early assembly steps

  • Proximity labeling techniques: Methods like BioID or APEX can identify proteins in close proximity to Pkr1 during different stages of assembly

  • Cryo-electron microscopy: This can provide structural insights into the Pkr1-mediated assembly intermediates

How can researchers effectively interpret contradictory data in Pkr1 functional studies?

When encountering contradictory results in Pkr1 research:

  • Consider strain background differences: Different yeast strains may have compensatory mechanisms affecting Pkr1 mutant phenotypes

  • Evaluate experimental conditions: Growth defects of pkr1Δ cells are most evident under specific conditions such as iron limitation or elevated calcium levels

  • Assess the specificity of readouts: Some assays may detect partial V-ATPase functionality while others require fully assembled complexes

  • Compare with other assembly factor mutants: Unlike typical V-ATPase assembly mutants, pkr1Δ cells can still assemble functional V-ATPases, though at reduced levels

  • Consider quantitative vs. qualitative effects: Pkr1 may affect the efficiency of assembly rather than causing complete loss of function

  • Account for bias in data collection: As with all research data, be aware of potential biases in experimental design and data interpretation

What are the most effective strategies for generating pkr1 deletion strains in S. pombe?

To generate pkr1 deletion strains:

  • PCR-based gene targeting: Use primers with ~72 bp homology to pkr1 flanking regions to amplify a selection marker (e.g., hphMX4 for hygromycin resistance)

  • Transformation protocol: Transform S. pombe cells (strain 972 / ATCC 24843) using lithium acetate/PEG method with the deletion cassette

  • Selection strategy: Select transformants on hygromycin-containing media

  • Verification methods:

    • PCR verification using primers outside the deletion region

    • Southern blot analysis

    • Western blot analysis to confirm absence of Pkr1 protein

  • Complementation testing: Reintroduce the pkr1 gene to verify that the observed phenotypes are due to the pkr1 deletion

For conditional alleles, consider using the Cre-loxP system or an inducible promoter system to control pkr1 expression.

What phenotypic assays are most informative for characterizing pkr1 mutants?

Several phenotypic assays provide valuable information about pkr1 mutant function:

  • Growth assays:

    • Growth on iron-limited media (shows significant impairment)

    • Growth on media with elevated calcium (may show sensitivity)

    • Growth in the presence of latrunculin A (may show increased sensitivity)

  • Vacuolar acidification:

    • Quinacrine staining to visualize acidic compartments

    • BCECF-AM or other pH-sensitive fluorescent dyes to quantify vacuolar pH

  • V-ATPase assembly and localization:

    • Immunoprecipitation to assess V0-V1 association

    • Fluorescence microscopy to track localization of tagged V-ATPase subunits

    • Western blotting to measure levels of V-ATPase subunits, particularly Vph1p

  • Iron/copper metabolism:

    • Assays for high-affinity iron transport

    • Copper loading of Fet3p

    • Iron-sensitive enzyme activities

  • Genetic interaction studies:

    • Synthetic genetic array analysis to identify genetic interactions

    • Double mutant analysis with other V-ATPase assembly factors (e.g., vma21)

How might structural biology approaches advance our understanding of Pkr1 function?

Structural biology approaches offer significant potential:

  • Cryo-electron microscopy (cryo-EM): Could reveal how Pkr1 interacts with V-ATPase subunits during assembly

  • X-ray crystallography: Challenging due to Pkr1's membrane protein nature, but could provide high-resolution structural information if crystals can be obtained

  • NMR spectroscopy: For studying dynamics of specific domains or interactions with other assembly factors

  • Molecular dynamics simulations: Can provide insights into how Pkr1 interacts with membrane environments and V-ATPase components

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of Pkr1 involved in protein-protein interactions during assembly

Understanding the structural basis of Pkr1's interaction with other assembly factors and V-ATPase subunits could lead to models of how these proteins collaborate during the assembly process.

What are the implications of Pkr1 research for understanding human diseases associated with V-ATPase dysfunction?

Pkr1 research has broader implications:

  • Conservation of assembly mechanisms: Many principles of V-ATPase assembly are conserved from yeast to humans

  • Disease relevance: V-ATPase dysfunction is associated with various human diseases including osteopetrosis, renal tubular acidosis, neurodegeneration, and cancer

  • Therapeutic potential: Understanding assembly mechanisms may lead to new therapeutic strategies for modulating V-ATPase activity

  • Comparative analysis opportunity: Comparing the PKR1 assembly pathway with human PROKR1 (not directly related but similarly named) could uncover parallel signaling mechanisms in different biological contexts

  • Model for studying rare diseases: The yeast system provides an accessible model for understanding complex assembly defects that may underlie human disease

How can pluralistic qualitative research approaches enhance Pkr1 functional studies?

Applying pluralistic qualitative research (PQR) approaches to Pkr1 studies could:

  • Combine multiple methodological perspectives: Integrating biochemical, genetic, and cell biological approaches to gain more holistic insights into Pkr1 function

  • Address ontological ambiguities: Help resolve contradictions in Pkr1 function across different experimental systems or conditions

  • Reduce researcher bias: By incorporating multiple analytical frameworks and acknowledging limitations in experimental design and data interpretation

  • Create more robust research questions: Formulate questions that explore Pkr1 function across multiple dimensions rather than from a single perspective5

  • Facilitate interdisciplinary collaboration: Encourage researchers from different disciplines to contribute their perspectives on V-ATPase assembly

This approach acknowledges that complex biological phenomena like V-ATPase assembly are better understood through multiple complementary methods rather than a single experimental paradigm.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.