Recombinant Schizosaccharomyces pombe Vacuolar ATPase assembly integral membrane protein vph2 (vph2)

What is the structure and function of Vacuolar ATPase assembly integral membrane protein vph2?

Vacuolar ATPase assembly integral membrane protein vph2 (vph2) is a 186-amino acid integral membrane protein found in Schizosaccharomyces pombe. The protein has a molecular structure that includes transmembrane domains, with the complete amino acid sequence being: MLKELRLHNRNINFLEFLRGVQIVPSDSVFLGEIDENSHTQDNTTTSILKEKELYDGIPLLPSMAGVSMDPEREKKSELRLMKNQISAIINILFTVVGTVTAVWYCTSSLSIEKKIALCAFSAILVLVADTFLYVRYLSAQPVRTSKNHTRQIIYTWTTNDPVLQSNEQLAIELGAIPSLKEKKNQ .

Functionally, vph2 is involved in the assembly of the V-ATPase complex, which is responsible for organelle acidification in all eukaryotic cells. V-ATPases are proton pumps that regulate pH in various cellular compartments, particularly the vacuole in yeast cells. The vph2 protein is part of the machinery that ensures proper assembly of this complex, thereby contributing to pH homeostasis and various cellular processes dependent on appropriate acidification of organelles .

How is recombinant S. pombe vph2 typically expressed and purified for research use?

Recombinant S. pombe vph2 protein is typically expressed in E. coli expression systems, allowing for controlled production of the full-length protein (1-186 amino acids). The protein is commonly tagged with an N-terminal polyhistidine tag (His-tag), which facilitates purification through affinity chromatography .

For expression, the gene encoding vph2 is cloned into an appropriate expression vector and transformed into E. coli. After induction of protein expression, cells are harvested and lysed. The His-tagged protein is then purified from the cell lysate using nickel or cobalt affinity resins that bind specifically to the His-tag. Following elution, the protein undergoes quality control assessments, including SDS-PAGE to determine purity (typically >90% for research applications) . The purified protein is then lyophilized or stored in an appropriate buffer, often containing stabilizers such as trehalose, to maintain its structural integrity during storage .

What are the optimal storage conditions for recombinant vph2 protein?

Optimal storage of recombinant vph2 protein involves several key considerations to maintain protein stability and functionality. The lyophilized powder form of the protein should be stored at -20°C or -80°C upon receipt . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity .

For reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure all content is at the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage of reconstituted protein, adding glycerol to a final concentration of 5-50% (with 50% being commonly used) and aliquoting before storage at -20°C/-80°C is advised . The typical storage buffer for this protein is a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability .

How does vph2 contribute to V-ATPase regulation in response to changes in extracellular pH?

The vph2 protein plays a significant role in V-ATPase assembly and thereby influences how V-ATPases respond to changes in extracellular pH. Research has shown that yeast V-ATPase activity is regulated by extracellular pH, with approximately 57% higher V-ATPase activity observed in vacuoles isolated from cells grown at an extracellular pH of 7 compared to those grown at pH 5 in minimal medium .

Interestingly, under conditions of neutral extracellular pH (pH 7), the V-ATPase becomes largely insensitive to reversible disassembly that typically occurs during glucose deprivation. Instead, it maintains a low vacuolar pH and high levels of V₁ subunit assembly, ATPase activity, and proton pumping even during energy limitation . This suggests that vph2, as a protein involved in V-ATPase assembly, participates in an integrated response system where both pH and metabolic inputs determine the final assembly state and activity of the V-ATPase.

The mechanism appears to prioritize maintaining V-ATPase activity when alternative mechanisms of vacuolar acidification are not available, even at the cost of energy consumption during glucose limitation. This adaptive response indicates that vph2 is part of a sophisticated regulatory network that balances energy conservation with the essential need for organelle acidification .

What molecular interactions does vph2 engage in during the assembly of the V-ATPase complex?

While the specific molecular interactions of vph2 during V-ATPase assembly are not fully detailed in the provided search results, we can infer several aspects of its function based on its classification as a V-ATPase assembly integral membrane protein. The vph2 protein likely serves as a scaffold or chaperone that facilitates the proper assembly of the V-ATPase complex components.

The V-ATPase is a multi-subunit complex consisting of two main sectors: the peripheral V₁ domain, which hydrolyzes ATP, and the membrane-embedded V₀ domain, which translocates protons. The assembly of these components requires precise coordination and proper spatial organization, particularly in the context of the membrane environment where vph2 is located.

As an integral membrane protein, vph2 likely interacts with the transmembrane components of the V₀ domain, potentially facilitating their correct insertion, orientation, or assembly within the membrane. Its role may be particularly important during the reversible assembly/disassembly process that regulates V-ATPase activity in response to energy availability and pH conditions . The fact that the V-ATPase becomes insensitive to glucose-dependent disassembly under certain pH conditions suggests that vph2 may participate in signaling pathways that integrate pH and metabolic cues to determine V-ATPase assembly state.

How does the spatial organization of vph2 compare to other membrane proteins in S. pombe?

While the search results don't provide specific information about the spatial organization of vph2 relative to other membrane proteins in S. pombe, we can draw some inferences from the information about nanoscale architecture studies of S. pombe proteins.

Studies using super-resolution microscopy techniques like fluorescence photoactivation localization microscopy (fPALM) have been employed to determine the precise spatial distribution of proteins in S. pombe, particularly those involved in the contractile ring during cytokinesis . Similar approaches could be applied to study the spatial organization of vph2 and other membrane proteins.

The nanoscale architecture studies of S. pombe have revealed that some membrane-associated protein complexes are organized in distinct layers at specific distances from the plasma membrane. For instance, F-BAR proteins like Cdc15, Imp2, and Rga7 have been shown to have their C-termini extending away from membrane-bound domains, reaching into intermediate layers approximately 100 nm from the membrane .

By analogy, vph2 as an integral membrane protein involved in V-ATPase assembly likely has a specific spatial organization within the membrane, potentially with domains extending into the cytoplasm to facilitate interactions with other V-ATPase components. Understanding this spatial organization would provide valuable insights into the mechanism of V-ATPase assembly and regulation.

What are the recommended protocols for reconstituting lyophilized recombinant vph2 protein?

Reconstitution of lyophilized recombinant vph2 protein requires careful handling to maintain protein integrity and functionality. The recommended protocol based on the search results is as follows:

• Initial preparation: Briefly centrifuge the vial containing lyophilized protein prior to opening to ensure all material is at the bottom of the vial .

• Reconstitution: Dissolve the lyophilized protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL .

• Stabilization: For long-term storage of the reconstituted protein, add glycerol to a final concentration of 5-50% (with 50% being commonly recommended) . This helps prevent protein denaturation during freeze-thaw cycles.

• Aliquoting: Divide the reconstituted protein into small working aliquots to avoid repeated freeze-thaw cycles of the entire sample .

• Storage: Store working aliquots at 4°C for up to one week or at -20°C/-80°C for extended storage .

This reconstitution protocol ensures that the recombinant vph2 protein maintains its structural integrity and functional properties for experimental use. The addition of glycerol is particularly important as it serves as a cryoprotectant, preventing ice crystal formation that could damage the protein structure during freezing.

What tagging strategies are most effective for studying vph2 localization and interactions in vivo?

While the search results don't provide specific information about tagging strategies for vph2, we can draw on information about fluorescent protein tagging approaches used for other S. pombe proteins to suggest effective strategies.

For in vivo studies of protein localization and interactions in S. pombe, endogenous tagging with fluorescent proteins has proven to be a highly effective approach. Based on the methodologies described for other S. pombe proteins, the following tagging strategies would likely be effective for vph2:

• C-terminal tagging: Endogenous C-terminal fluorophore fusion can be created by transforming S. pombe with a pFA6a integration cassette amplified with gene-specific primers for insertion at the 3' end of the vph2 open reading frame . This approach preserves the natural promoter and expression levels of the protein.

• N-terminal tagging: For N-terminal tagging of vph2, a construct containing (1) a 500 bp 5' flank, (2) a fluorescent protein like mMaple3 or GFP with a GGGGSGGGGSG C-terminal linker, (3) the vph2 coding sequence, and (4) a 500 bp 3' flank could be assembled and transformed into S. pombe . Since vph2 is a transmembrane protein, careful consideration of tag placement is crucial to avoid disrupting membrane insertion or protein function.

• Photoactivatable fluorophore tags: For super-resolution microscopy studies, photoactivatable fluorophores like mMaple3 would be particularly valuable. mMaple3 has advantages over other photoactivatable fluorophores like mEos3.2, including a faster maturation time (49 versus 330 min) .

• FRET pairs: For studying protein-protein interactions, tagging vph2 and potential interaction partners with fluorescence resonance energy transfer (FRET) compatible fluorophores would allow for detection of close molecular associations in vivo .

When designing tagging strategies for vph2, it's important to consider that it is an integral membrane protein, so the tag placement should not interfere with membrane targeting or insertion. Additionally, the use of short linkers between the tag and protein can help minimize positional uncertainty in localization studies.

What experimental approaches can be used to study vph2's role in V-ATPase assembly and regulation?

Several experimental approaches can be employed to investigate vph2's role in V-ATPase assembly and regulation, drawing from methodologies described in the search results:

• Vacuolar pH measurement: Monitoring vacuolar pH using pH-sensitive fluorescent probes can help assess the functional impact of vph2 on V-ATPase activity. This approach has been used to demonstrate higher V-ATPase activity (57%) in vacuoles isolated from cells grown at pH 7 compared to pH 5 .

• V-ATPase activity assays: Biochemical assays measuring ATP hydrolysis and proton pumping can directly quantify V-ATPase activity in response to different conditions or genetic manipulations of vph2 . These assays typically involve isolating vacuolar membrane fractions and measuring either ATP consumption or proton translocation rates.

• V-ATPase assembly state analysis: The assembly state of V-ATPase can be analyzed by biochemical fractionation and western blotting to detect the association of V₁ subunits with the membrane-bound V₀ domain. This approach has been used to demonstrate that V-ATPases maintain high levels of V₁ subunit assembly during glucose deprivation when cells are grown at neutral pH .

• Genetic approaches: Creating vph2 deletion or conditional mutants in S. pombe would allow for assessment of its necessity for V-ATPase assembly and function. Complementation studies with wild-type or mutated versions of vph2 could identify critical domains or residues.

• Super-resolution microscopy: Techniques like fluorescence photoactivation localization microscopy (fPALM) could be used to determine the precise spatial distribution of vph2 and other V-ATPase components relative to the membrane, providing insights into the structural organization of the complex .

• FRET analysis: Fluorescence resonance energy transfer experiments could detect direct interactions between vph2 and other V-ATPase components, helping to map the protein interaction network involved in complex assembly .

• Response to environmental changes: Studying how V-ATPase assembly and activity change in response to glucose availability and extracellular pH in wild-type versus vph2-manipulated cells would provide insights into vph2's role in integrating these signals .

These multifaceted approaches would provide comprehensive insights into vph2's role in V-ATPase assembly, regulation, and function within the context of cellular pH homeostasis and energy metabolism.

How can researchers distinguish between direct and indirect effects of vph2 on V-ATPase function?

Distinguishing between direct and indirect effects of vph2 on V-ATPase function requires a combination of experimental approaches and careful data interpretation:

• Proximity analysis: Super-resolution microscopy techniques like fPALM can determine the precise spatial relationship between vph2 and V-ATPase components . Physical proximity would support direct interactions, while spatial separation might suggest indirect effects.

• Interaction studies: Direct physical interactions can be assessed using techniques such as FRET, co-immunoprecipitation, or cross-linking mass spectrometry. Positive results would indicate direct effects of vph2 on V-ATPase components .

• Temporal analysis: Examining the timing of changes in vph2 localization or modification relative to changes in V-ATPase assembly state can help establish cause-and-effect relationships. For instance, if vph2 changes precede V-ATPase reassembly in response to glucose readdition, this would support a direct regulatory role.

• Domain mapping: Creating truncated or mutated versions of vph2 can identify specific domains required for V-ATPase assembly. This approach can distinguish which aspects of vph2 function are directly involved in V-ATPase regulation versus other cellular functions.

• Comparative analysis with known regulators: Comparing the effects of vph2 manipulation with those of well-characterized V-ATPase regulators can help position vph2 within the regulatory network. For example, determining whether vph2 affects the same aspects of V-ATPase function as factors involved in glucose-dependent regulation .

• Bypass experiments: Testing whether artificially tethering V-ATPase components together can bypass the need for vph2 would indicate that vph2's primary role is in assembly rather than having additional regulatory functions.

• Systems biology approach: Integrating data from multiple experimental approaches, including transcriptomics, proteomics, and functional assays, can help distinguish direct molecular effects from broader cellular responses to vph2 manipulation.

By triangulating results from these different approaches, researchers can build a more complete picture of vph2's precise role in V-ATPase assembly and regulation, distinguishing direct molecular actions from downstream or compensatory effects.

What are the potential pitfalls in interpreting results from experiments with recombinant vph2 protein?

When working with recombinant vph2 protein, several potential pitfalls in data interpretation should be considered:

• Protein misfolding: As an integral membrane protein, vph2 may not fold correctly when expressed in E. coli, which lacks the membrane environment and specialized folding machinery of eukaryotic cells . This could lead to artifacts in functional studies or interaction assays. Researchers should verify proper folding using techniques such as circular dichroism spectroscopy or limited proteolysis.

• Tag interference: The presence of tags, such as the N-terminal His-tag commonly used for purification , may interfere with protein function or interactions. Control experiments comparing tagged and untagged proteins, or comparing differently tagged versions, would help identify any tag-related artifacts.

• In vitro versus in vivo behavior: The behavior of purified recombinant vph2 in vitro may not accurately reflect its function in the complex cellular environment. The protein normally exists in a lipid bilayer and interacts with numerous other proteins, conditions that are difficult to replicate in vitro. Complementary in vivo experiments are essential for validating in vitro findings.

• Storage-related degradation: Improper storage or repeated freeze-thaw cycles can lead to protein degradation or aggregation , potentially affecting experimental results. Researchers should regularly check protein integrity by SDS-PAGE before experiments and be cautious about interpreting results from proteins stored for extended periods.

• Buffer conditions: The activity of membrane proteins like vph2 can be highly sensitive to buffer composition, pH, and the presence of detergents or lipids. Results may vary significantly with different experimental conditions, necessitating careful optimization and standardization.

• Homology limitations: When extrapolating functions of vph2 between different species, researchers should be aware that despite sequence homology, the precise functions or regulatory mechanisms may differ. Species-specific validation is important for comparative studies.

• Concentration effects: Using non-physiological concentrations of recombinant protein may lead to artificial interactions or functions. Titration experiments and comparison with estimated endogenous concentration ranges would help identify concentration-dependent artifacts.

To mitigate these pitfalls, researchers should employ multiple complementary approaches, include appropriate controls, and validate key findings using both in vitro and in vivo experimental systems.

How can researchers integrate data from vph2 studies with broader understanding of V-ATPase function across species?

Integrating data from vph2 studies with the broader understanding of V-ATPase function across species requires a systematic approach that bridges molecular details with evolutionary context:

• Comparative genomics: Identifying vph2 homologs across species and analyzing their sequence conservation can reveal evolutionarily conserved domains likely critical for function. Sequence alignment tools and phylogenetic analysis can map the evolutionary relationships of vph2 proteins and correlate structural features with functional divergence or conservation.

• Structure-function correlation: Where structural data is available for vph2 or its homologs, mapping functional data onto these structures can provide insights into how molecular mechanisms are conserved or adapted across species. This approach can identify conserved interaction interfaces or regulatory sites.

• Cross-species functional complementation: Testing whether vph2 from one species can rescue phenotypes in another species lacking its own vph2 homolog can provide direct evidence of functional conservation. Such experiments have been powerful in establishing evolutionary conservation of V-ATPase regulatory mechanisms.

• Systems-level comparison: Examining how V-ATPase regulation responds to environmental cues like pH changes and glucose availability across different species can reveal conserved regulatory principles. The observation that yeast V-ATPase activity increases by 57% when cells are grown at pH 7 versus pH 5 provides a basis for comparative studies in other organisms.

• Integration with disease models: Connecting findings from S. pombe vph2 studies with mammalian V-ATPase-related disease models can help translate basic research insights into biomedical applications. This approach is particularly valuable given that V-ATPase dysfunction is implicated in various human diseases.

• Meta-analysis approach: Systematically combining data from multiple studies across species using meta-analysis techniques can identify robust patterns in V-ATPase regulation that transcend species-specific details. This approach can help distinguish fundamental mechanisms from species-specific adaptations.

• Collaborative database development: Contributing to and utilizing specialized databases that integrate V-ATPase component data across species would facilitate cross-species comparisons and hypothesis generation. Such resources could map molecular interactions, functional domains, and regulatory mechanisms in a comparative framework.

By integrating data across these multiple levels, researchers can develop a more comprehensive understanding of how vph2 contributes to V-ATPase function within the broader evolutionary context, potentially revealing fundamental principles of organelle acidification regulation that apply across eukaryotic life.