Recombinant Schizosaccharomyces pombe Vacuolar protein sorting-associated protein 55 (vps55)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant S. pombe Vps55

Recombinant Vps55 is produced by fusing the full-length vps55 gene (1–128 amino acids) from S. pombe with an N-terminal histidine (His) tag for purification. Key specifications include:

PropertyDetail
Source OrganismSchizosaccharomyces pombe
Expression HostEscherichia coli
Protein Length128 amino acids
Molecular Weight~14 kDa
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in deionized water with 5–50% glycerol for stability
SequenceMSDLRKIIGLSSVLAVGFMLVILSCALFKNWYPLLIVIPFILAPLPNLLTKKYSTSHDFLQEEDRNLLDFGRFTFGATICTGFALPIVFVNVGLIGTAAATMSCVGGSIIFLVITLYSQAFVQHEEEF

This recombinant protein is essential for studying vacuolar sorting mechanisms in fission yeast and homologous pathways in eukaryotes .

Functional Interactions

Vps55 collaborates with proteins involved in vesicular fusion and cargo recognition:

Interaction PartnerRoleEvidence
Vps68Vesicular transport regulationCo-occurrence score: 0.990
Bem46Membrane organization and buddingCo-occurrence score: 0.756
Vps10Sorting receptor for vacuolar hydrolasesCo-occurrence score: 0.749
Sec17Vesicular fusion via SNAP complexCo-occurrence score: 0.543

Phenotypic Defects in Mutants

  • CPY Missorting: vps55Δ mutants secrete immature carboxypeptidase Y (Golgi form) due to impaired endosome-to-vacuole trafficking .

  • Delayed Degradation: Endocytic markers like uracil permease transiently accumulate in late endosomes, indicating disrupted vacuolar delivery .

  • Evolutionary Conservation: Human OB-RGRP (obesity receptor gene-related protein) complements vps55Δ defects, highlighting functional conservation across eukaryotes .

Applications in Research

Recombinant Vps55 is utilized to:

  • Elucidate retrograde trafficking mechanisms in S. pombe.

  • Study lysosomal sorting disorders by analogy to human OB-RGRP pathways.

  • Develop screens for vacuolar protein sorting (VPS) gene interactions .

Comparative Analysis with Homologs

OrganismProteinFunctionKey Difference
S. cerevisiaeVps55pLate endosome-to-vacuole trafficking; CPY sortingLarger size (140 amino acids)
Homo sapiensOB-RGRPLysosomal sorting; linked to metabolic regulationFunctional overlap with yeast Vps55
DictyosteliumVps55 homologEndosomal traffickingShorter sequence (125 amino acids)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
vps55; SPAC630.11; Vacuolar protein sorting-associated protein 55
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
vps55
Target Protein Sequence
MSDLRKIIGLSSVLAVGFMLVILSCALFKNWYPLLIVIPFILAPLPNLLTKKYSTSHDFL QEEDRNLLDFGRFTFGATICTGFALPIVFVNVGLIGTAAATMSCVGGSIIFLVITLYSQA FVQHEEEF
Uniprot No.

Target Background

Function
Vacuolar protein sorting-associated protein 55 (vps55) is involved in protein transport from endosomes to the vacuole.
Database Links
Protein Families
OB-RGRP/VPS55 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Vps55 and what is its role in S. pombe?

Vps55p is a small membrane protein with four predicted transmembrane domains that plays a critical role in endosomal transport in Schizosaccharomyces pombe. It forms a complex with Vps68p that functions with or downstream of the ESCRT (Endosomal Sorting Complexes Required for Transport) machinery to regulate endosomal trafficking. The Vps55/68 complex mediates a novel, conserved step in the endosomal maturation process that is essential for proper sorting of proteins through the endosomal system .

Where is Vps55 localized within the cell?

Vps55p has been reported to act at the late endosome and colocalizes with the endosomal marker Snf7p. Through double-label immunofluorescence microscopy of cells coexpressing differently tagged forms of Vps68p and Vps55p, researchers have determined that these proteins colocalize at the vacuolar limiting membrane and adjacent punctate structures that contain Vps21p but are devoid of the late Golgi marker Sec7p, indicating they are endosomes .

How conserved is Vps55 across species?

Vps55 is well-conserved across species, from yeast to humans. Despite being a relatively small protein with four membrane-spanning domains, Vps55 has orthologues in higher organisms, including humans, suggesting its fundamental importance in cellular transport mechanisms. This evolutionary conservation highlights the significance of Vps55's function in endosomal trafficking across eukaryotic lineages .

What is the relationship between Vps55 and Vps68?

Vps55p and Vps68p form a physical complex that regulates endosomal transport. This interaction has been confirmed through coimmunoprecipitation experiments, where immunoprecipitation of Vps68p with anti-HA antibodies led to the coprecipitation of Vps55p from CHAPSO-solubilized cell lysates. Importantly, the steady-state levels of both proteins are dependent on each other - the absence of one partner significantly reduces the stability of the other. Expression studies suggest that the Vps55/68 complex may contain multiple copies of Vps55p, as Vps55-HA appeared to be expressed at higher levels than Vps68-HA .

What are the recommended methods for epitope tagging Vps55 for detection?

For effective epitope tagging of Vps55, researchers have successfully employed several strategies. One validated approach involves amplifying the VPS55 gene from genomic DNA using primers that add restriction sites (such as 5' XbaI), followed by digestion and cloning into an appropriate vector (e.g., pRS315). Quickchange mutagenesis can then be used to create a BamHI site immediately before the stop codon. Multiple epitope tags have been successfully used with Vps55, including triple AU1, myc tags, or triple-HA tags, with each construction properly complementing the CPY-sorting defect of vps55Δ strains. This indicates the tagged proteins retain functionality .

How can researchers generate recombinant Vps55 for in vitro studies?

To generate recombinant Vps55 for in vitro studies, the following protocol is recommended:

  • Construct design: Clone the VPS55 coding sequence into an expression vector containing:

    • A strong inducible promoter appropriate for your expression system

    • An affinity tag (His6, GST, or MBP) to facilitate purification

    • A precision protease cleavage site between the tag and Vps55

  • Expression optimization:

ParameterRecommended conditionsNotes
Expression systemE. coli BL21(DE3) for initial attempts; consider insect cell systems if membrane protein folding is problematicAs a membrane protein, Vps55 may require special conditions for proper folding
Induction temperature16-18°CLower temperatures reduce inclusion body formation
Induction time16-20 hoursLonger, gentler induction for membrane proteins
Inducer concentration0.1-0.5 mM IPTGStart with lower concentrations
Additives5-10% glycerol in mediaStabilizes membrane proteins
  • Membrane protein solubilization: Since Vps55 is a transmembrane protein, solubilization with appropriate detergents is critical. CHAPSO has been successfully used for Vps55 extraction from cellular membranes in co-immunoprecipitation experiments .

What phenotypic assays can be used to study Vps55 function?

Several phenotypic assays have been established to study Vps55 function:

  • CPY sorting assay: Carboxypeptidase Y (CPY) is a vacuolar hydrolase that follows the CPY pathway from the ER through the Golgi to the vacuole. In vps55Δ strains, CPY sorting is defective. This can be monitored by following the fate of CPY using Western blotting or pulse-chase analysis to detect missorting to the cell surface .

  • Fluorescent reporter tracking: GFP-tagged membrane proteins such as Ste3, Sna3, and ALP have been used to monitor trafficking defects in vps55Δ strains. Changes in localization patterns or degradation kinetics of these reporters provide insights into specific trafficking steps affected by Vps55 loss .

  • Genome-scale phenotypic analysis: A biochemical assay measuring CPY secretion can be used for large-scale analysis of yeast knockout mutants to define the relative contribution of each gene, including VPS55, to endosomal transport. This approach allows for unbiased identification of genes involved in specific transport pathways .

How can interactions between Vps55 and other proteins be studied?

To study interactions between Vps55 and other proteins, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP): Express differently tagged forms of Vps55 and potential interacting partners in the same cell. Solubilize membranes with an appropriate detergent (CHAPSO has been successfully used), perform immunoprecipitation with antibodies against one tag, and detect coprecipitated proteins by Western blotting with antibodies against the other tag. This method successfully demonstrated the interaction between Vps55p and Vps68p .

  • Yeast two-hybrid analysis: While this system has limitations for membrane proteins, modified membrane yeast two-hybrid systems can be employed with appropriate controls to minimize false positives.

  • Proximity-based labeling: Techniques like BioID or APEX can be adapted for S. pombe to identify proteins in close proximity to Vps55 in its native cellular environment.

  • Fluorescence microscopy: Colocalization studies using differently tagged proteins can provide evidence for potential interactions, as was done to show Vps55p and Vps68p colocalize at the vacuolar limiting membrane and endosomal structures .

How does the Vps55/68 complex interact with the ESCRT machinery?

The Vps55/68 complex appears to act with or downstream of ESCRT function to regulate endosomal trafficking. To investigate this interaction mechanistically, researchers should consider:

  • Genetic interaction studies: Create double mutants combining vps55Δ with deletions of various ESCRT components to identify synthetic growth defects or phenotypic enhancement/suppression.

  • Temporal analysis of trafficking: Use live-cell imaging with fluorescent protein fusions to determine the temporal relationship between ESCRT function and Vps55/68 activity in endosomal maturation.

  • Biochemical fractionation: Isolate endosomal compartments at different stages of maturation to determine the recruitment timing of Vps55/68 relative to ESCRT components.

Current research indicates that loss of Vps68p disrupts recycling to the TGN (trans-Golgi network) as well as onward trafficking to the vacuole without preventing the formation of lumenal vesicles within the MVB (multivesicular body). This suggests the Vps55/68 complex mediates a distinct step in endosomal maturation that is separate from but coordinated with ESCRT-mediated processes .

What is the molecular mechanism by which Vps55 regulates membrane trafficking?

The molecular mechanism of Vps55 function remains incompletely understood. To elucidate this:

  • Structure-function analysis: Generate point mutations or domain swaps in Vps55's transmembrane domains to identify regions critical for function, complex formation, or localization.

  • Lipidomic analysis: Compare lipid compositions of endosomal membranes in wild-type versus vps55Δ cells to determine if Vps55 affects membrane lipid composition.

  • In vitro reconstitution: Develop purified component systems with recombinant Vps55/68 complex and artificial membrane vesicles to test for direct effects on membrane properties or fusion events.

The observed disruption in trafficking patterns in vps55Δ mutants suggests this protein may function in regulating membrane fusion or fission events during endosomal maturation, potentially by affecting membrane curvature or receptor clustering .

How does Vps55 contribute to protein quality control in S. pombe?

Endosomal sorting is critical for cellular protein quality control. To investigate Vps55's role:

  • Proteomics approach: Compare the vacuolar proteome between wild-type and vps55Δ strains to identify specific cargo proteins whose degradation depends on Vps55.

  • Stress response analysis: Test sensitivity of vps55Δ strains to various cellular stresses (heat shock, oxidative stress, ER stress) that trigger increased protein degradation.

  • Ubiquitination patterns: Examine global ubiquitination patterns in vps55Δ versus wild-type cells to determine if specific ubiquitin-dependent sorting pathways are affected.

The role of Vps55 in endosomal maturation suggests it may particularly affect the turnover of plasma membrane proteins that undergo endocytosis and subsequent degradation in the vacuole, potentially impacting cellular processes ranging from receptor downregulation to adaptation to environmental changes .

What are common challenges in expressing recombinant Vps55 and how can they be addressed?

Expressing recombinant Vps55 presents several challenges common to membrane proteins:

ChallengeSolutionRationale
Poor expressionUse codon-optimized sequence for expression hostImproves translation efficiency
Inclusion body formationLower induction temperature (16°C) and use slower inductionAllows proper folding time for membrane proteins
Protein instabilityAdd protease inhibitors immediately after cell lysisPrevents degradation during purification
Aggregation during purificationScreen multiple detergents; start with CHAPSO which has worked for Vps55Different detergents have varying efficiency for membrane protein solubilization
Low functional yieldConsider fusion partners (MBP, SUMO)Enhances solubility while maintaining function
Difficulty confirming proper foldingCircular dichroism (CD) spectroscopy to verify secondary structureEnsures the recombinant protein has proper structural elements

Additionally, when working with Vps55, remember that its stability depends on Vps68p. Co-expression of both proteins may improve yields and stability of recombinant Vps55 .

How can researchers overcome difficulties in detecting Vps55-protein interactions?

When investigating Vps55 interactions, researchers often encounter challenges:

  • Weak or transient interactions: Use crosslinking reagents prior to lysis (e.g., DSP or formaldehyde) to capture transient interactions.

  • Improper membrane solubilization: Test a panel of detergents beyond CHAPSO, including digitonin, DDM, or LMNG, which preserve different types of membrane protein interactions.

  • Low abundance of Vps55: Use overexpression systems with caution, as they may disrupt normal stoichiometry. Consider using tandem affinity purification (TAP) tags to increase sensitivity.

  • False negatives in yeast two-hybrid: For membrane proteins like Vps55, consider split-ubiquitin membrane yeast two-hybrid systems specifically designed for membrane proteins.

  • Complex formation requirements: Remember that Vps55p and Vps68p form a complex, and studying interactions with other proteins may require the intact complex rather than individual proteins .

What considerations are important when analyzing vps55Δ phenotypes?

When analyzing phenotypes of vps55Δ strains, several important considerations should be kept in mind:

  • Genetic background effects: Always compare mutant strains to isogenic wild-type controls. Genetic background differences can significantly affect endosomal trafficking phenotypes.

  • Complementation controls: Include complementation with wild-type VPS55 to confirm phenotypes are specifically due to loss of Vps55 function.

  • Indirect effects: Since deletion of VPS55 affects steady-state levels of Vps68p, some phenotypes may be due to loss of the entire complex rather than Vps55-specific functions .

  • Growth conditions: Endosomal sorting phenotypes can vary with growth conditions. Standardize and report culture conditions (medium, temperature, growth phase).

  • Multiple assay approach: As endosomal sorting affects multiple cargo proteins differently, use several trafficking assays (CPY sorting, fluorescent reporter localization) to comprehensively characterize phenotypes.

How might systems biology approaches advance our understanding of Vps55 function?

Systems biology approaches offer powerful tools to contextualize Vps55 function within broader cellular networks:

  • Genome-wide genetic interaction mapping: Systematic analysis of genetic interactions (synthetic lethality, suppression) between vps55Δ and other gene deletions can reveal functional relationships. This approach has already helped place Vps55 in a cluster with Vps68 and Vps21, suggesting functional relationships (p value = 1.51 × 10^-13; sorting index = 87.6) .

  • Quantitative proteomics: SILAC or TMT-based proteomics comparing protein abundance changes in wild-type versus vps55Δ cells can identify affected pathways beyond known cargo proteins.

  • Phosphoproteomics: Analysis of phosphorylation changes in vps55Δ cells may reveal signaling pathways that respond to or regulate Vps55 function.

  • Integration with transcriptomics: Combining protein localization, abundance, and transcript level data can provide insights into compensatory mechanisms activated when Vps55 function is lost.

  • Network analysis: Computational integration of these datasets can position Vps55 within the cellular interactome and predict additional functions or regulatory mechanisms.

What are promising approaches to determine the structure of the Vps55/68 complex?

Determining the structure of membrane protein complexes like Vps55/68 presents significant challenges. Promising approaches include:

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have made it possible to determine structures of smaller membrane proteins. Sample preparation would involve:

    • Purification of the intact Vps55/68 complex in suitable detergents or nanodiscs

    • Optimization of sample concentration and grid conditions

    • Potentially employing antibody fragments to increase particle size

  • X-ray crystallography with fusion partners: Fusion of crystallization chaperones (e.g., T4 lysozyme) to flexible loops could facilitate crystal packing while preserving the transmembrane domain structure.

  • Integrative structural biology: Combining lower-resolution structural data with computational modeling, crosslinking mass spectrometry, and evolutionary coupling analysis could generate reliable structural models.

  • NMR spectroscopy: For specific domains or smaller fragments of Vps55/68, solution or solid-state NMR could provide high-resolution structural information.

Understanding the structure would significantly advance our knowledge of how this complex mediates endosomal trafficking at the molecular level.

How could Vps55 research contribute to understanding human disease?

Research on Vps55 has implications for human health due to the conservation of endosomal trafficking mechanisms:

  • Neurodegenerative disease connections: Endosomal dysfunction is implicated in multiple neurodegenerative diseases. The human orthologues of Vps55 could be investigated in cellular models of Alzheimer's or Parkinson's disease.

  • Cancer progression: Dysregulation of endosomal trafficking affects receptor recycling and degradation, potentially influencing cancer cell signaling. Studies could examine expression levels of human Vps55 orthologues in tumor samples.

  • Infectious disease applications: Many pathogens hijack host endosomal pathways. Understanding the function of Vps55 could reveal mechanisms of pathogen entry or immune evasion.

  • Therapeutic targeting: The Vps55/68 complex represents a potential therapeutic target for diseases involving endosomal dysfunction. High-throughput screens could identify small molecules that modulate its activity.

  • Biomarker development: Alterations in endosomal trafficking proteins might serve as biomarkers for disease progression or treatment response in conditions with known endosomal defects.

Translating findings from S. pombe Vps55 research to human cells requires careful validation, but the high conservation of endosomal sorting mechanisms makes this a promising avenue for future investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.