Recombinant Schizosaccharomyces pombe Vacuolar transporter chaperone 2 (vtc2)

Shipped with Ice Packs
In Stock

Description

General Information

Schizosaccharomyces pombe is a species of yeast used as a model organism to study cellular processes such as DNA damage repair, mitotic recombination, and chromatin structure . Genetic studies have identified around 50 genes in S. pombe linked to human diseases, including diabetes, hereditary deafness, and cystic fibrosis .

Vtc2 Function and Characteristics

Vtc2 is a vacuolar transporter chaperone. S. pombe has three annotated polyphosphatases: Ppx1, SPBC713.07c, and SPCC1840.07c, the latter two of which are designated as vacuolar .

Siw14 Characterization

Siw14 is a cysteinyl-phosphatase-family pyrophosphatase enzyme capable of hydrolyzing the phosphoanhydride . It acts as an agonist of precocious RNA polymerase II (Pol2) transcription termination dependent on the 3' cleavage and polyadenylation factor (CPF) complex .

Recombinant S. pombe Siw14 as a Metal-Independent Phosphohydrolase

Recombinant S. pombe Siw14 is produced in Escherichia coli as His10Smt3 fusions and isolated from soluble bacterial extracts using Ni-affinity chromatography . The tags are removed using the Smt3 protease Ulp1, and the SpSiw14 proteins are recovered free of His10Smt3 after a second round of Ni-affinity chromatography .

Substrate Specificity and Genetic Interactions

Siw14 deletion or inactivation does not affect S. pombe growth but is lethal in the absence of the Nudix-type inositol pyrophosphate pyrophosphatase enzyme Aps1 . The synthetic lethality of siw14aps1∆ depends on the synthesis of 1,5-IP8 by the Asp1 kinase . SpSiw14 and the Aps1 pyrophosphatases have essential but redundant functions in fission yeast, and their synthetic lethality results from the toxic effects of too much 1,5-IP8 .

Mitotic Recombination Assays in S. pombe

S. pombe is a system for studying DNA damage repair . Several in vivo genetic assays have been developed to study mitotic recombination outcomes, the repair mechanism of DNA double-strand breaks .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vtc2; SPAC14C4.11; Vacuolar transporter chaperone 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-734
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
vtc2
Target Protein Sequence
MRFSDSIEAGIYEPWRDKYMNYPELKHLLKTEEEAPSWGENDESKFVSVMDAQLEKVYAF HLEILKELNESVDWVKSKVSASQEPDGPPISKEEAIKLLERLDSCTETVKKLEKYTRLNL TGFFKIVKKHDKLYPGYSLRPVFQVRLRACPLGSVQFNPLLAEIFSLYNTLRDGLSAPSN SVQVKPKHEHNVDYNSSMYRRRTFRFWVHPDNVMEVKTYIMRHLPVLYYSGKQGFDKDQN GVSGILDPISTCLYLDNSNFDLYSQNLERSEQAYSLRLHWYGKLTPKTDIIVERMVRQGS TLSHSEDRFTIREKKVRELLSGRYDFRKVEDDHSTTASDQKKKLIEDVEQLIVDNHLQPV LRSVYTRTAFQIPGDDEVRINLDSDWVMIREDSLDIERPCRDPEDWHRHDIDDADFPYKH LRKGEYSRFPYSVLEIRECVRYDEDEPLWISELRNSHLISEIDGFSKYEHGVAILFEKYV SLLPMWVFSMDQDIRKDLQEVYSHPEGSAGSRNVYIKRRNQRVLKQNMTPEPSQPSPLVN RLKANEMHPVSEEPEDNREVYRNEHGDHFNFRSIPGLLKPSTYGSFKHHGKTFVTPPHIK KPEIPLRVSGPIKVEAKVWLANERTFLKWLHVVVLLGSLALALYNSAGERLGQAFGVVYT LLAIFIGFYAWKLHAKRSQMIKSRSPAPMTDYWGPLIVGTALAISLIVNMSFALKDAVYQ NLIEPDRLLVKLFT
Uniprot No.

Target Background

Function
A component of the vacuolar transporter chaperone (VTC) complex, playing a crucial role in vacuolar membrane fusion.
Database Links
Protein Families
VTC2/3 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Vacuolar transporter chaperone 2 (vtc2) in Schizosaccharomyces pombe?

Vtc2 is a 734-amino acid protein that functions as a component of the Vacuolar Transporter Chaperone (VTC) complex in fission yeast (S. pombe). This complex plays a crucial role in polyphosphate (polyP) synthesis and phosphate homeostasis . The full-length protein sequence (1-734aa) contains multiple transmembrane domains and is involved in phosphate transport mechanisms across the vacuolar membrane. The Vtc2 protein in S. pombe belongs to a conserved family of proteins found in various lower eukaryotes that participate in inorganic phosphate (Pi) homeostasis .

  • What is the primary function of the VTC complex in S. pombe?

The VTC complex in S. pombe functions primarily as a polyphosphate (polyP) polymerase and translocase. This dual functionality enables the complex to:

  • Synthesize polyP chains using ATP as a substrate

  • Facilitate the translocation of synthesized polyP across the vacuolar membrane

  • Maintain intracellular phosphate homeostasis

  • Contribute to cellular stress responses

These functions are critical for managing phosphate levels in the cell, preventing cytotoxic accumulation of free phosphate, and creating phosphate reserves for periods of nutrient limitation .

  • How does the S. pombe VTC complex composition compare to S. cerevisiae?

The composition of VTC complexes differs between these yeast species:

ComponentS. pombeS. cerevisiaeFunction
Vtc1PresentPresentStructural component of VTC complex
Vtc2PresentPresentForms Vtc4/Vtc2/Vtc1 complex
Vtc4PresentPresentCatalytic subunit for polyP synthesis
Vtc3Not identifiedPresentForms Vtc4/Vtc3/Vtc1 complex
Vtc5AbsentPresentPolyP synthesis activator

S. cerevisiae contains two distinct VTC complexes (Vtc4/Vtc3/Vtc1 and Vtc4/Vtc2/Vtc1), while the composition in S. pombe appears somewhat simplified, primarily utilizing Vtc1, Vtc2, and Vtc4 components . The S. cerevisiae VTC complex forms a heteropentameric structure, but the exact stoichiometry of the S. pombe complex has not been as thoroughly characterized .

Experimental Approaches

  • What methods are used to express and purify recombinant S. pombe vtc2?

Recombinant S. pombe vtc2 is typically expressed and purified using the following methodology:

  • Expression system: E. coli is the preferred expression system for producing recombinant S. pombe vtc2 .

  • Tagging: The protein is usually fused with an N-terminal His-tag to facilitate purification.

  • Purification steps:

    • Metal affinity chromatography (using the His-tag)

    • Size exclusion chromatography to increase purity

  • Buffer conditions: Typically Tris/PBS-based buffer with 6% trehalose at pH 8.0 for final storage.

  • Storage: The purified protein can be stored as a lyophilized powder or in solution with added glycerol (typically 50%) at -20°C/-80°C .

This approach yields protein with greater than 90% purity as determined by SDS-PAGE, suitable for functional and structural studies.

  • How can researchers assess the functionality of recombinant vtc2 protein?

The functionality of recombinant vtc2 can be assessed through several complementary approaches:

  • In vitro polyP synthesis assay:

    • Incubate purified vtc2 with ATP and other VTC complex components

    • Monitor polyP formation using fluorescent dyes such as DAPI that exhibits a spectral shift upon binding to polyP

    • Quantify the rate of polyP synthesis in the presence or absence of activators like inositol pyrophosphates (PP-InsPs)

  • Vacuolar isolation and functional reconstitution:

    • Isolate vacuoles from S. pombe using methods adapted from S. cerevisiae protocols

    • Reconstitute the VTC complex using recombinant components

    • Measure ATP-dependent polyP synthesis activity

  • Complementation assays:

    • Transform vtc2-deficient S. pombe strains with plasmids expressing the recombinant vtc2

    • Assess restoration of polyP synthesis and phosphate homeostasis

    • Evaluate cellular phenotypes like growth under phosphate limitation

  • Protein-protein interaction studies:

    • Use pull-down assays to verify interactions with other VTC complex components

    • Confirm complex assembly through co-immunoprecipitation or cross-linking studies

Advanced Research Questions

  • How does the SPX domain of vtc2 regulate polyphosphate synthesis?

The SPX domain of vtc2 plays a critical regulatory role in polyphosphate synthesis through the following mechanisms:

  • Inositol pyrophosphate (PP-InsP) binding: The SPX domain serves as a sensor for cellular phosphate status by binding to inositol pyrophosphates, which are signaling molecules that respond to phosphate availability.

  • Allosteric regulation: Upon binding PP-InsPs, the SPX domain undergoes conformational changes that are transmitted to the catalytic domain of the VTC complex, stimulating polyP polymerase activity. This stimulation is particularly pronounced at low ATP concentrations, suggesting a role in coordinating energy status with phosphate storage .

  • Complex activation: Experimental evidence from the related S. cerevisiae system shows that InsP6 and PP-InsPs can enhance polyP synthesis by more than 10-fold in isolated vacuoles, highlighting the importance of this regulatory mechanism .

  • Structural basis: The SPX domain's position within the VTC complex architecture allows it to communicate between the sensing of phosphate status and the catalytic machinery, creating an elegant feedback system for phosphate homeostasis.

This SPX domain-mediated regulation represents an evolutionarily conserved mechanism that ensures polyP synthesis occurs under appropriate cellular conditions and in response to phosphate availability .

  • What are the key structural features of the VTC complex that enable its dual polymerase and translocase functions?

The dual functionality of the VTC complex as both a polyP polymerase and translocase is enabled by several critical structural features:

  • Heteromeric assembly: The complex forms a heteropentameric structure with precisely positioned subunits that create distinct functional domains. In S. cerevisiae, this consists of one Vtc4, one Vtc3, and three Vtc1 subunits arranged in a specific architecture .

  • Channel formation: The transmembrane domains form a dedicated polyP-selective channel:

    • Inner ring formed by TM1 helices from multiple subunits

    • Outer ring composed of TM2 and TM3 helices

    • Tapering pore structure that narrows toward the intravacuolar side

  • Catalytic domain positioning: The catalytic domain is strategically located above the polyP channel entrance, creating an electropositive pathway that guides the negatively charged polyP chains toward the channel .

  • Gating mechanism: A latch-like horizontal helix in Vtc4 controls channel access, regulating when synthesized polyP can enter the translocation pathway .

  • Coupling mechanism: The arrangement of domains creates functional coupling between polyP synthesis and translocation, preventing toxic accumulation of polyP in the cytoplasm .

Although these structural features have been most thoroughly characterized in S. cerevisiae, the high conservation of the VTC complex suggests similar principles apply to the S. pombe complex, with potential species-specific variations in regulatory mechanisms.

  • How do mutations in vtc2 affect phosphate homeostasis and cellular phenotypes in S. pombe?

Mutations in vtc2 have significant impacts on phosphate homeostasis and result in several cellular phenotypes:

  • Disrupted polyphosphate synthesis: Loss of vtc2 function leads to reduced accumulation of polyphosphate in vacuoles, limiting the cell's ability to store phosphate reserves .

  • Synergistic effects with other Pi regulators: In S. pombe, vtc2 works in concert with other phosphate regulators including:

    • Xpr1/Spx2: A plasma membrane phosphate exporter

    • Pqr1: A ubiquitin ligase that downregulates phosphate importers

Deletion of vtc4 (the catalytic core of the VTC complex) along with either or both of these regulators creates synthetic phenotypes, demonstrating their cooperative roles in phosphate homeostasis .

  • Phosphate sensitivity phenotypes: The following phenotypic patterns emerge when vtc2/vtc4 function is compromised:

    • Single deletion of vtc4 is viable but shows reduced polyP content

    • Double deletion of vtc4 and pqr1 leads to growth defects

    • Triple deletion of xpr1, pqr1, and vtc4 is nearly lethal in normal phosphate conditions but can survive at lower phosphate concentrations

  • Elevated cellular phosphate levels: Disruption of the VTC complex results in increased levels of free phosphate in the cytoplasm, which can become toxic to cells at high concentrations .

These findings highlight the essential role of vtc2 as part of a multi-component system for maintaining phosphate homeostasis, with mutations revealing the intricate balance required for proper cellular function.

  • What is the relationship between S. pombe vtc2 and RNA splicing regulation?

A surprising relationship between vtc2 and RNA splicing has been revealed through recent research:

In fission yeast S. pombe, a protein named Rtf2 affects splicing and has been particularly associated with splicing of transcripts related to DNA replication fork barriers. Rtf2 physically associates with mRNA processing and splicing factors, and deletion of rtf2 causes increased intron retention in specific transcripts .

While not directly studied for vtc2, this example from S. pombe demonstrates that proteins involved in seemingly unrelated cellular processes (like DNA replication and RNA splicing) can have unexpected secondary functions. This raises important questions about potential additional roles of vtc2 that might extend beyond phosphate homeostasis, particularly:

  • Whether vtc2 might influence splicing of specific transcripts related to phosphate metabolism

  • If there are feedback mechanisms between phosphate homeostasis and mRNA processing

  • Whether the VTC complex has moonlighting functions in nuclear processes

This represents an emerging area for investigation that could significantly expand our understanding of vtc2's cellular functions beyond its established role in the VTC complex .

Technical Considerations

  • What are the challenges in ensuring proper folding and activity of recombinant S. pombe vtc2?

Producing functionally active recombinant S. pombe vtc2 presents several challenges:

  • Transmembrane domain issues: Vtc2 contains transmembrane domains that can cause folding problems when expressed in heterologous systems like E. coli:

    • The C-terminal region includes hydrophobic transmembrane segments that may aggregate

    • Proper membrane insertion is difficult to achieve in bacterial expression systems

  • Complex formation requirements: Vtc2 naturally functions as part of a multi-protein complex:

    • The protein may require interaction with other VTC components for stability

    • Some functional assays may only work with the reconstituted complex rather than isolated Vtc2

  • Post-translational modifications: Potential modifications in S. pombe might not occur in E. coli:

    • Phosphorylation sites that may regulate activity

    • Other modifications that affect protein-protein interactions

  • Buffer optimization: The protein typically requires:

    • Tris/PBS-based buffers with 6% trehalose at pH 8.0

    • Addition of glycerol (5-50%) for long-term storage

    • Careful handling to avoid repeated freeze-thaw cycles

  • Functional validation approaches: Confirming activity requires:

    • Reconstitution with other VTC components

    • Specialized assays for polyP synthesis

    • Confirmation of proper folding through circular dichroism or limited proteolysis

Researchers can address these challenges by expressing truncated versions lacking the transmembrane domains for structural studies, or by using alternative expression systems like yeast for full-length protein production.

  • How can researchers study the interaction between vtc2 and other components of the VTC complex?

Researchers can employ several complementary approaches to study the interactions between vtc2 and other VTC complex components:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of vtc2 and potential binding partners

    • Immunoprecipitate with antibodies against the tag

    • Identify co-precipitated proteins through western blotting or mass spectrometry

    • This approach successfully demonstrated that in S. cerevisiae, no direct interaction exists between Vtc2 and Vtc3

  • Proximity-based labeling:

    • Utilize techniques like BioID or TurboID where a biotin ligase is fused to vtc2

    • The ligase biotinylates proteins in close proximity

    • Identify labeled proteins by streptavidin pulldown followed by mass spectrometry

    • This approach was used with Rtf2 in S. pombe to identify associated proteins

  • Yeast two-hybrid assays:

    • Test direct protein-protein interactions in a heterologous system

    • Can be modified to use membrane protein fragments for transmembrane proteins

  • Fluorescence microscopy with tagged proteins:

    • Visualize co-localization of fluorescently tagged vtc2 with other complex components

    • Track dynamics of complex assembly using live-cell imaging

  • In vitro reconstitution:

    • Express and purify individual components

    • Reconstitute the complex in vitro

    • Verify complex formation using size exclusion chromatography, analytical ultracentrifugation, or native PAGE

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers to capture protein-protein interactions

    • Identify crosslinked peptides by mass spectrometry

    • Map interaction interfaces at the residue level

These approaches can provide complementary information about the composition, stoichiometry, and dynamics of vtc2-containing complexes in S. pombe.

  • What are the key differences in phosphate homeostasis mechanisms between S. pombe and S. cerevisiae, and how does this impact vtc2 research?

Key differences in phosphate homeostasis between these yeast species significantly impact vtc2 research:

FeatureS. pombeS. cerevisiaeResearch Implications
PHO pathwayLacks SPX-CDK inhibitor (Pho81)Contains complete PHO pathway with Pho81Different transcriptional regulation mechanisms must be considered in experimental design
VTC complex compositionSimpler composition with Vtc1, Vtc2, Vtc4Two distinct complexes: Vtc4/Vtc3/Vtc1 and Vtc4/Vtc2/Vtc1Experiments from one species may not directly translate to the other
Pi exporterXpr1 functions as a Pi exporterSyg1 (Xpr1 ortholog) has not been well-studied for Pi exportDifferent components for phosphate efflux
RegulationLong non-coding RNAs and RNA polymerase II C-terminal domain phosphorylationPP-InsP-dependent CDK regulationDifferent genetic tools needed for manipulation
Pi transporter downregulationPqr1 regulates Pi importersDifferent regulatory mechanismDifferent genetic backgrounds needed for functional studies

These differences have several implications for vtc2 research:

  • Experimental design: Findings from S. cerevisiae cannot be directly extrapolated to S. pombe without verification.

  • Genetic manipulation strategies: Different genetic backgrounds and compensatory mechanisms must be considered when creating mutants.

  • Assay development: Phosphate homeostasis assays may require species-specific adaptations.

  • Evolutionary biology: Studying both systems provides insights into the evolution of phosphate regulation mechanisms.

  • Model selection: Depending on the specific research question, one yeast species may be more appropriate than the other.

Understanding these species-specific differences is crucial for designing well-controlled experiments and correctly interpreting results in vtc2 research.

Research Applications

  • How can recombinant vtc2 be used in studies of phosphate metabolism disorders?

Recombinant vtc2 can serve as a valuable tool in phosphate metabolism disorder studies through several applications:

  • Model system development:

    • S. pombe with modified vtc2 can model aspects of mammalian phosphate homeostasis disorders

    • The conservation of basic phosphate regulation mechanisms makes yeast a relevant simplified system

    • Mutant versions of vtc2 can be created to mimic disease-associated variants of related proteins

  • Drug screening platform:

    • Development of high-throughput assays using recombinant vtc2 to identify compounds that modulate polyP synthesis

    • Screening for molecules that affect phosphate transport across membranes

    • Identification of compounds that might restore function to defective phosphate homeostasis proteins

  • Structural biology applications:

    • Determination of vtc2 structure and complex assembly to guide rational drug design

    • Understanding the molecular mechanisms of phosphate regulation that may be conserved in higher eukaryotes

    • Identification of potential binding sites for therapeutic compounds

  • Biomarker development:

    • Utilization of recombinant vtc2 to develop assays for detecting abnormal phosphate metabolism

    • Creation of antibodies against vtc2 for use in diagnostic applications

    • Development of activity assays that could be adapted for clinical samples

  • Functional studies of disease mechanisms:

    • In vitro reconstitution of phosphate transport systems to study the effect of mutations

    • Investigation of how polyP levels affect cellular processes relevant to disease states

    • Examination of the interplay between phosphate homeostasis and other cellular pathways disrupted in metabolic disorders

While S. pombe is evolutionarily distant from humans, the conservation of fundamental mechanisms in phosphate homeostasis makes vtc2 research relevant to understanding and potentially treating human phosphate metabolism disorders .

  • What are the emerging roles of polyphosphate in cellular stress responses, and how can vtc2 research contribute to this field?

Polyphosphate (polyP) has several emerging roles in cellular stress responses, and vtc2 research can significantly contribute to this field:

  • PolyP functions in stress responses:

    • Acts as a phosphate reserve during nutrient limitation

    • Chelates toxic metal ions, providing protection against heavy metal stress

    • Serves as an energy buffer during periods of metabolic stress

    • Participates in protein folding and prevents protein aggregation

    • Regulates oxidative stress responses

  • Contributions of vtc2 research to understanding these mechanisms:

    • Manipulating vtc2 expression allows controlled modulation of cellular polyP levels

    • Studying vtc2 mutants helps identify novel functions of polyP in stress response

    • Structural studies of the VTC complex including vtc2 illuminate how polyP synthesis is regulated under stress conditions

    • Comparative studies between S. pombe and other organisms highlight conserved stress response pathways

  • Experimental approaches using vtc2:

    • Creating conditional vtc2 mutants to study acute responses to stress

    • Developing sensors based on vtc2 to monitor polyP dynamics during stress

    • Using vtc2 knockout strains to identify polyP-dependent and polyP-independent stress responses

    • Engineering vtc2 variants with altered regulation to understand adaptive responses

  • Integration with other stress response pathways:

    • Investigation of crosstalk between phosphate homeostasis and other stress signaling pathways

    • Examination of how polyP synthesized by the VTC complex interfaces with general stress response mechanisms

    • Study of temporal dynamics of polyP synthesis during different phases of stress response

This research direction not only advances fundamental understanding of cellular physiology but also has potential applications in biotechnology, where engineered strains with enhanced stress tolerance are desirable for industrial processes .

  • How does the study of S. pombe vtc2 contribute to our understanding of eukaryotic phosphate transport evolution?

The study of S. pombe vtc2 provides valuable insights into the evolution of eukaryotic phosphate transport systems:

  • Evolutionary positioning of the VTC complex:

    • The S. pombe VTC complex represents an intermediate evolutionary stage between simpler prokaryotic systems and more complex phosphate regulation in higher eukaryotes

    • Comparative genomics reveals that VTC components are present in diverse lower eukaryotes but absent in plants and mammals, suggesting alternative phosphate storage mechanisms evolved in higher organisms

  • Conservation and divergence of SPX domains:

    • The SPX domain in vtc2 and other VTC components is evolutionarily conserved across various organisms

    • This domain serves as a phosphate sensor through inositol pyrophosphate binding

    • The presence of SPX domains in different phosphate regulatory proteins across species highlights a common ancestral mechanism for phosphate sensing

  • Comparative analysis with other phosphate transport systems:

    • S. pombe contains six SPX-domain proteins involved in different aspects of phosphate homeostasis

    • Comparison with S. cerevisiae reveals both conserved mechanisms and species-specific adaptations

    • This suggests evolutionary plasticity in phosphate regulation systems

  • Divergent mechanisms for phosphate regulation:

    • S. pombe lacks the Pho81 SPX-CDK inhibitor found in S. cerevisiae

    • Instead, it employs alternative regulatory mechanisms involving RNA polymerase II C-terminal domain phosphorylation and long non-coding RNAs

    • This represents evolutionary divergence in regulatory mechanisms while maintaining the same physiological outcome

  • Implications for understanding human phosphate disorders:

    • While humans lack VTC complexes, the fundamental principles of phosphate homeostasis are conserved

    • Lessons from S. pombe vtc2 contribute to understanding how phosphate transport systems evolved and diversified

    • This knowledge helps identify potential targets for intervention in human phosphate disorders

This evolutionary perspective enhances our understanding of not only fungal biology but also the broader principles of phosphate regulation across the tree of life .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.