Recombinant Schizosaccharomyces pombe Vacuolar transporter chaperone 4 (vtc4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
vtc4; SPCC1322.14c; Vacuolar transporter chaperone 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-721
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
vtc4
Target Protein Sequence
MKFGQLLKETLMYEYKYSYVNYDKLKKEIKRRNDQGGWSEEDESDFVELLEKELDKVYSF QKNKSAEVMERIRFCEEQTDEVVRRLDSDNPPNENDFAILETELTDIMATVHDLAKFSEL NYTAFYKIIKKHDKHTGWILKPVFAARLNAKPFFKEQYDLLVVKLSKLYDFVRTRGSPIK GDSAAGGTQQNFVRQTTKYWVHPNNVTELKIYILKHLPVLVFNPNKEFAREDAAITSIYY DNDDLDFYLGRLEKREGAEAIRLRWYGNMDNNNIFVERKTHREDWTGEKSVKARFPLKEK YVNAFLRGDYTVEEAFAKMRKDGKKSLKEIESLERLAKEVQYTVLSRGMKPYVRSFYERT AFQLPGDARVRISLDTNLSLIREDGPSRAGNNWRRMDIGIDYPFDQLPDEDIVRFPYAIL EVKLQTQFGQDPPEWVNNLVNSHLVEAVPKFSKFIHGVSTLFYDRVTLLPYWFPQMDIDI RKPATHTFIQGRSQSGTHSSSVSANVLTDSENTPIHADGDNYVDEESRIGSSSTRNDNST FQTSDSFQELDERTNLLDISKRKGRDSFVAALNSRLKDIKDSFFLETVPKFEEPTEPTVI YEQKYVSPPGKRIYVPVRVEPKTYFALERTYLDYLRYSILMGSIGITLFSFAKTRSGILG AASFTLVALFAIFYSTFLYLWRAVNIAKHNAVRYDDRFGPTAICVITFAAISANVILNFN A
Uniprot No.

Target Background

Function
A component of the vacuolar transporter chaperone (VTC) complex, playing a crucial role in vacuolar membrane fusion.
Database Links
Protein Families
VTC4 family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the function of Vtc4 in Schizosaccharomyces pombe?

Vtc4 in S. pombe is a critical component responsible for polyphosphate (polyP) synthesis. As evidenced by research, S. pombe strains with vtc4 deletion (vtc4Δ) show undetectable levels of polyP when analyzed using PAGE analysis of phenol-extracted polyP. The protein contains an SPX domain (named after SYG1/Pho81/XPR1 proteins) that coordinates the binding of inositol polyphosphates, which are essential for its regulatory function in polyP synthesis .

How does S. pombe Vtc4 differ from its S. cerevisiae counterpart?

While both S. pombe and S. cerevisiae Vtc4 proteins are responsible for polyP synthesis, they are regulated differently. In S. cerevisiae, Vtc4 is primarily regulated by Kcs1-generated 5-IP7, whereas in S. pombe, the regulation appears to be dependent on IP8 generated by the Asp1 enzyme. This fundamental difference highlights evolutionary divergence in polyP regulation between these two yeast species that diverged approximately 350 million years ago .

What cellular compartments contain Vtc4 in S. pombe?

Vtc4 in S. pombe is primarily associated with vacuolar membranes as part of the VTC (Vacuolar Transporter Chaperone) complex. This localization is consistent with its role in synthesizing polyP, which accumulates in the vacuole. The protein contains a SPX domain that serves as a regulatory region for binding inositol polyphosphates, similar to other phosphate homeostasis proteins .

What are the optimal conditions for culturing S. pombe for studies involving Vtc4?

For optimal growth conditions when studying S. pombe Vtc4, researchers should use rich media like YE5S for general maintenance and experiments measuring polyP levels. When studying nutrient-dependent effects on Vtc4 function, minimal media with varying nitrogen sources (such as ammonium, glutamate, or proline) can be used to examine how nutrient availability affects Vtc4 activity and polyP synthesis. Growth temperature should be maintained at 30°C for standard conditions, and cells should be harvested during logarithmic growth phase for consistent results .

How can I design experiments to study the relationship between Vtc4 and TOR signaling?

To study the relationship between Vtc4 and TOR signaling, a comprehensive approach should include:

  • Creating vtc4 deletion strains and strains with mutations in TOR pathway components

  • Treating cells with TOR inhibitors such as Torin1 to reduce both TORC1 and TORC2 signaling

  • Measuring polyP levels under different nutrient conditions with and without TOR inhibition

  • Performing fitness profiling under various nutrient conditions (rich vs. minimal media)

  • Analyzing the transcriptional response of vtc4 to TOR inhibition

This design allows for understanding how nutrient sensing through the TOR pathway might influence Vtc4 activity. Quantifying polyP levels after PAGE analysis of phenol-extracted samples will provide direct evidence of how TOR signaling affects Vtc4 function .

What methods are available for measuring Vtc4 activity and polyP levels in S. pombe?

Several methodological approaches can be used to measure Vtc4 activity and polyP levels in S. pombe:

  • PAGE analysis of phenol-extracted polyP - This is the standard method used to visualize and quantify polyP levels in yeast cells. Cells are grown to logarithmic phase, polyP is extracted using a phenol-based method, and then separated on polyacrylamide gels.

  • Genetic analysis of vtc4Δ strains - Comparing polyP levels between wild-type and vtc4Δ strains provides direct evidence of Vtc4's contribution to polyP synthesis.

  • In vitro enzyme assays - Purified recombinant Vtc4 can be used in enzymatic assays to directly measure polyP synthesis activity.

  • Fluorescent polyP staining - For cellular localization studies, DAPI staining can be used to visualize polyP in vivo, as it gives a distinctive emission wavelength when bound to polyP versus DNA.

These methods can be complemented with gene expression analysis and protein localization studies to comprehensively characterize Vtc4 function .

How can I generate a vtc4 deletion strain in S. pombe?

Generating a vtc4 deletion strain in S. pombe involves a targeted gene replacement approach. The process includes:

  • Designing primers to amplify a selectable marker (typically ura4+ or kanMX6) flanked by 80-100bp sequences homologous to regions upstream and downstream of the vtc4 gene.

  • Transforming S. pombe cells with the PCR product using the lithium acetate method.

  • Selecting transformants on appropriate media (lacking uracil for ura4+ marker or containing G418 for kanMX6).

  • Confirming the deletion by PCR using primers outside the integration site and within the marker gene.

  • Verifying the phenotype by measuring polyP levels using PAGE analysis.

For complementation studies or expressing modified versions of Vtc4, the gene can be reintroduced at its native locus or at an ectopic site using similar homologous recombination techniques .

What are the key considerations when generating recombinant Vtc4 variants for functional studies?

When generating recombinant Vtc4 variants for functional studies, several key considerations must be addressed:

Similar to approaches used with Asp1 variants, Vtc4 variants can be designed to test specific functional hypotheses about domain functions and regulatory mechanisms .

How can I study the interaction between Vtc4 and inositol polyphosphates in S. pombe?

To study the interaction between Vtc4 and inositol polyphosphates in S. pombe, researchers can employ several approaches:

  • Genetic manipulation of inositol polyphosphate synthesis pathways:

    • Generate strains with deletions or mutations in genes involved in inositol polyphosphate metabolism (such as asp1)

    • Create double mutants combining vtc4 variants with inositol polyphosphate synthesis mutants

  • Biochemical approaches:

    • Express and purify the SPX domain of Vtc4 for in vitro binding assays with synthetic inositol polyphosphates

    • Perform co-immunoprecipitation experiments to identify protein interactions dependent on inositol polyphosphates

  • Structural biology:

    • Use crystallography or cryo-EM to determine the structure of the Vtc4 SPX domain bound to various inositol polyphosphates

  • Functional correlation:

    • Measure polyP levels in strains with altered inositol polyphosphate profiles

    • Correlate changes in specific inositol polyphosphate species (particularly IP8 in S. pombe) with Vtc4 activity

These approaches can reveal how different inositol polyphosphates regulate Vtc4 function and explain the differences in regulation between S. pombe and S. cerevisiae .

How do I interpret contradictory results between S. pombe and S. cerevisiae Vtc4 studies?

When faced with contradictory results between S. pombe and S. cerevisiae Vtc4 studies, consider the following interpretative framework:

  • Evolutionary divergence - S. pombe and S. cerevisiae diverged approximately 350 million years ago, allowing for significant evolutionary differences in regulatory mechanisms. For example, while S. cerevisiae Vtc4 activity is regulated by Kcs1-generated 5-IP7, S. pombe Vtc4 appears to be regulated by Asp1-generated IP8 .

  • Experimental conditions - Differences in growth conditions, media composition, or cell harvest timing can affect results. Ensure comparable experimental conditions when making cross-species comparisons.

  • Genetic background differences - Consider the broader genetic context, including redundant pathways or compensatory mechanisms that might exist in one species but not the other.

  • Methodological variations - Different polyP extraction and analysis methods can lead to varying results. Standardize methods when comparing across species.

  • Regulatory network complexity - Map the entire regulatory network in both species to understand contextual differences that might explain contradictory results.

When reporting such contradictions, present data from both species side by side with explicit controls, as shown in the research comparing polyP levels in wild-type, vtc4Δ, and vip1Δ/asp1Δ strains from both yeasts .

What are common issues in polyP extraction from S. pombe and how can they be resolved?

Common issues in polyP extraction from S. pombe and their resolutions include:

  • Low yield of polyP:

    • Ensure cells are harvested during logarithmic growth when polyP levels are highest

    • Optimize cell lysis conditions, especially for S. pombe which has a robust cell wall

    • Use fresh phenol for extraction and avoid repeated freeze-thaw cycles

  • Degradation of polyP:

    • Add EDTA to inhibit phosphatases that might degrade polyP

    • Maintain samples at 4°C during extraction and processing

    • Process samples quickly to minimize exposure to endogenous phosphatases

  • Contamination with nucleic acids:

    • Include additional purification steps such as DNase and RNase treatment

    • Use differential precipitation methods to separate polyP from nucleic acids

    • Verify purity by examining absorption spectra and DAPI staining characteristics

  • Inconsistent gel migration:

    • Standardize gel polyacrylamide concentration (typically 15-20%)

    • Include size markers for polyP chains

    • Maintain consistent buffer conditions during electrophoresis

  • Quantification challenges:

    • Use densitometry of stained gels with standard curves of known polyP amounts

    • Consider specialized techniques like 31P-NMR for more accurate quantification

Implementing these solutions will lead to more reproducible and reliable polyP extraction from S. pombe .

How can I determine if my recombinant Vtc4 protein is properly folded and functional?

To determine if recombinant Vtc4 protein is properly folded and functional, employ these methodological approaches:

  • In vivo complementation assay:

    • Express the recombinant Vtc4 in a vtc4Δ strain

    • Measure restoration of polyP synthesis using PAGE analysis

    • Compare polyP levels to wild-type cells

  • Protein localization:

    • Tag Vtc4 with a fluorescent protein and confirm proper vacuolar membrane localization

    • Co-localize with other VTC complex components to verify correct complex formation

  • In vitro activity assays:

    • Purify the recombinant protein and test for polyP synthesis activity

    • Assess binding of inositol polyphosphates to the SPX domain using binding assays

  • Structural analysis:

    • Use limited proteolysis to assess the protein's folding state

    • Employ circular dichroism to evaluate secondary structure content

    • Consider thermal shift assays to assess protein stability

  • Protein-protein interactions:

    • Verify interactions with known binding partners using co-immunoprecipitation

    • Test for proper complex formation with other VTC components

A combination of these approaches will provide comprehensive evidence for proper folding and functionality of the recombinant Vtc4 protein .

How does nutrient availability regulate Vtc4 activity and polyP synthesis in S. pombe?

Nutrient availability regulation of Vtc4 activity and polyP synthesis in S. pombe involves a complex signaling network:

  • TOR signaling pathway - The Target of Rapamycin (TOR) pathway is a central regulator of cellular responses to nutrient availability. In S. pombe, both TORC1 and TORC2 complexes can influence metabolic processes. Nutrient limitation reduces TORC1 signaling, which likely affects Vtc4 activity through downstream effectors .

  • Nitrogen source effects - Different nitrogen sources (ammonium, glutamate, proline) can significantly impact cellular fitness and potentially Vtc4 activity. This suggests that nitrogen-sensing pathways may regulate polyP synthesis in response to nitrogen quality and availability .

  • Inositol polyphosphate signaling - The regulation of Vtc4 by inositol polyphosphates (particularly IP8 in S. pombe) provides a link between nutrient sensing and polyP synthesis. Asp1, which generates IP8, may serve as an integrator of nutrient signals .

  • Vacuolar pH and ion homeostasis - Nutrient conditions affect vacuolar pH and ion concentrations, which may directly influence Vtc4 enzymatic activity.

To study these relationships experimentally, researchers should measure polyP levels under various nutrient conditions and in strains with mutations in nutrient-sensing pathway components while monitoring Vtc4 activity .

What is the relationship between Vtc4-mediated polyP synthesis and the TOR signaling pathway in S. pombe?

The relationship between Vtc4-mediated polyP synthesis and the TOR signaling pathway in S. pombe represents an important intersection of nutrient sensing and metabolic regulation:

  • TORC1 influences on polyP metabolism - TORC1 activity responds to nutrient availability and regulates multiple cellular processes. When TORC1 signaling is reduced (either by nutrient limitation or chemical inhibition with Torin1), cells must adapt their metabolism. This adaptation likely includes changes in polyP synthesis through effects on Vtc4 activity.

  • Transcriptional regulation - TOR signaling regulates transcription factors that control gene expression in response to nutrients. These may include factors that regulate VTC complex gene expression, including vtc4.

  • Post-translational modifications - TOR-dependent phosphorylation cascades might directly modify Vtc4 or other VTC complex components, altering their activity in response to nutrient conditions.

  • Inositol polyphosphate metabolism - TOR signaling may influence the activities of enzymes involved in inositol polyphosphate metabolism, such as Asp1, thereby indirectly regulating Vtc4 activity through changes in IP8 levels.

  • Experimental evidence - Fitness profiling of S. pombe strains under TOR inhibition (Torin1 treatment) and in different nutrient environments has identified genes involved in transmembrane transport, transcription, and chromatin organization as important for tolerating reduced TOR signaling, suggesting potential links to Vtc4 function .

Further research using phosphoproteomic analysis of Vtc4 under different TOR signaling states would help elucidate this relationship more precisely .

What are the evolutionary implications of the different regulatory mechanisms of Vtc4 between S. pombe and S. cerevisiae?

The divergent regulatory mechanisms of Vtc4 between S. pombe and S. cerevisiae offer profound evolutionary insights:

  • Regulatory rewiring - Despite conserving the core Vtc4 enzyme for polyP synthesis, these yeasts have evolved different regulatory inputs: S. cerevisiae uses Kcs1-generated 5-IP7, while S. pombe employs Asp1-generated IP8. This represents a clear example of regulatory network rewiring during evolution .

  • Adaptive significance - The different regulatory mechanisms may reflect adaptations to different ecological niches and nutrient environments encountered by these yeasts during their 350 million years of separate evolution.

  • Conservation of core machinery with flexible regulation - The conservation of the SPX domain in Vtc4 across species, combined with different regulatory molecules, suggests a pattern where core enzymatic machinery is preserved while regulatory mechanisms remain more flexible during evolution.

  • Functional redundancy and specialization - In S. cerevisiae, multiple pathways may regulate polyP synthesis, providing redundancy, while S. pombe may have evolved more specialized control mechanisms.

  • Implications for higher eukaryotes - Understanding these evolutionary differences provides insights into how phosphate homeostasis mechanisms might operate in more complex eukaryotes, including humans, where the SPX domain is found only in the phosphate exporter XPR1.

These evolutionary findings highlight the importance of studying multiple model organisms to fully understand conserved biological processes, as assumptions based on one model may not transfer to others or to human biology .

What expression systems are most effective for producing recombinant S. pombe Vtc4?

For effective production of recombinant S. pombe Vtc4, consider these expression system options:

  • Homologous expression in S. pombe:

    • Advantages: Native post-translational modifications and membrane insertion machinery

    • Methods: Integration at the native locus using the native promoter or inducible expression systems

    • Yields: Typically lower than heterologous systems but more likely to produce functional protein

    • Purification: Can be facilitated by adding affinity tags (His6, FLAG, etc.)

  • Expression in S. cerevisiae:

    • Advantages: Higher yields than S. pombe while still providing eukaryotic processing

    • Considerations: May require codon optimization and careful selection of promoters

    • Systems: GAL1 promoter for inducible expression or constitutive promoters like TDH3

  • Insect cell expression systems:

    • Advantages: High yields and proper folding of complex eukaryotic proteins

    • Systems: Baculovirus-infected Sf9 or High Five cells

    • Considerations: Requires generation of recombinant baculovirus but provides good membrane protein expression

  • Bacterial expression (with cautions):

    • Limitations: Membrane proteins like Vtc4 often misfold in bacteria

    • Potential solutions: Expression as truncated domains (e.g., SPX domain alone) or fusion with solubility tags

    • Systems: Specialized E. coli strains designed for membrane protein expression

For functional studies, homologous expression in S. pombe is recommended, while structural studies might benefit from higher-yield systems with appropriate modifications to ensure proper folding .

What purification strategies optimize yield and activity of recombinant Vtc4?

Optimal purification strategies for recombinant Vtc4 that maximize yield and preserve activity include:

Table 1: Comparison of Purification Strategies for Recombinant Vtc4

Purification StepMethodologyConsiderationsImpact on Activity
Cell LysisGentle mechanical disruption (glass beads for yeast)Avoid detergents until membrane extractionPreserves native conformation
Membrane ExtractionDifferential centrifugationSeparate vacuolar membranes from other cellular componentsEnriches for Vtc4 in native environment
Detergent SolubilizationMild detergents (DDM, LMNG)Test multiple detergents; start with 1% concentrationCritical for activity retention
Affinity ChromatographyIMAC (for His-tagged Vtc4)Include low imidazole in wash buffersGood initial purification
Size ExclusionSuperdex 200Confirms proper oligomeric stateRemoves aggregates
Stability EnhancementAddition of lipids, glycerolMimic native membrane environmentExtends active lifetime

Key considerations for maintaining Vtc4 activity include:

  • Temperature control - Maintain samples at 4°C throughout purification

  • Protease inhibitors - Include a complete cocktail to prevent degradation

  • Buffer optimization - Test pH range 6.5-7.5 and include stabilizing ions like Mg2+ and K+

  • Inositol polyphosphate inclusion - Consider adding IP8 to stabilize the active conformation

  • Reconstitution - For activity assays, reconstitute in liposomes or nanodiscs to provide a membrane environment

These strategies balance the need for purity with the requirement to maintain the native structure and activity of Vtc4 .

How can site-directed mutagenesis be used to investigate key functional domains of Vtc4?

Site-directed mutagenesis offers a powerful approach to investigate key functional domains of Vtc4. Strategic approaches include:

  • SPX domain mutations:

    • Target basic residues in the inositol polyphosphate binding pocket to disrupt IP8 binding

    • Mutate conserved residues across species to identify the core functional elements

    • Create chimeric proteins with SPX domains from S. cerevisiae to test species-specific regulation

  • Catalytic domain mutations:

    • Target predicted active site residues involved in polyP synthesis

    • Create mutations that might alter chain length determination

    • Investigate residues at the interface between subunits that might affect oligomerization

  • Membrane association regions:

    • Mutate hydrophobic regions predicted to interact with the vacuolar membrane

    • Modify potential lipid interaction sites that might regulate membrane association

  • Post-translational modification sites:

    • Identify and mutate potential phosphorylation sites (S/T/Y residues)

    • Create phosphomimetic mutations (S/T to D/E) or non-phosphorylatable mutations (S/T to A)

Experimental validation should follow a systematic approach similar to that used with Asp1 variants, where specific mutations targeting either the N-terminal kinase domain or C-terminal pyrophosphatase domain were created to modify IP8 levels and monitor their effects on polyP synthesis. For each Vtc4 mutant generated, researchers should assess:

  • Protein expression and stability

  • Proper localization to the vacuolar membrane

  • PolyP synthesis activity in vivo and in vitro

  • Response to nutrient conditions and TOR signaling

  • Binding affinity for inositol polyphosphates

This methodical approach will reveal structure-function relationships within the Vtc4 protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.