Recombinant Schizosaccharomyces pombe Zinc homeostasis factor 1 (zhf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
zhf1; zhf; SPAC23C11.14; Zinc homeostasis factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-387
Protein Length
full length protein
Species
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Target Names
zhf1
Target Protein Sequence
MFDLARQTRIILLLGIDVTFFFIEIITGYAIDSLALIADSFHMLNDIVSLLVALWATRLA HSTSHEPKYTYGWQRAEILGALSNGVFLIALCMFIFMEAIERFIEPPSVSNPTLMFFVGS LGLLSNFVGIFLFHDHGHDHPHTHTAQNYDFPEEDDIESVLPSTIVHRCNTSQQEVSHTH TQVADSATESSPLLSYTGNHNGAGTSKPVNNHGSIEQDAPKQTKKRNLNMHGVFLHVLGD ALGNIGVISAALFIKYTDYSWRFLFDPCISILLTFIILFSAIPLCKSAALILLQVAPQSI KLDDVSNLINHLDGVESVHELHIWQLSDVKLIATVHVCVTLPDDKGESYTKLTTDIRNVL QSFGIYDVTIQPEFANHPLLCDQGSSS
Uniprot No.

Target Background

Function
This protein is involved in zinc homeostasis, specifically its accumulation within the endoplasmic reticulum and nucleus. It also plays a role in cadmium sequestration within the endoplasmic reticulum.
Gene References Into Functions
  1. Zhf participates in removing excess cytosolic zinc, contributing to cellular zinc homeostasis in conjunction with the tightly regulated Zrt1. PMID: 18637840
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Zhf1 and what role does it play in zinc homeostasis in S. pombe?

Zhf1 is a zinc transporter in S. pombe that belongs to the Cation Diffusion Facilitator (CDF) family of proteins. It plays a crucial role in zinc detoxification by transporting excess zinc from the cytosol into the endoplasmic reticulum (ER) for storage. When analyzing cellular zinc homeostasis, it's important to understand that:

This bidirectional zinc trafficking system allows S. pombe to maintain zinc homeostasis within a narrow physiological range, illustrating the delicate balance between micronutrient deficiency and toxicity.

How does deletion of zhf1 affect zinc homeostasis in S. pombe?

Deletion of zhf1 dramatically alters the cell's ability to manage zinc levels, with multiple observable effects:

  • Cells lacking Zhf1 (zhf1Δ) are hypersensitive to elevated zinc concentrations due to their inability to sequester excess zinc

  • The transcriptional response to zinc becomes approximately 100-fold more sensitive in zhf1Δ cells

  • zhf1Δ cells show more pronounced upregulation of the zinc uptake gene zrt1 at both mRNA and protein levels when transferred to zinc-limiting conditions

  • Double mutants (zrt1Δ zhf1Δ) show an extremely narrow range of optimal zinc concentration for growth, approximately 20-40 μM Zn²⁺, compared to wild-type cells that grow optimally across a broad range from 2 μM to several millimolar Zn²⁺

These findings demonstrate that Zhf1 is essential for buffering changes in environmental zinc concentrations and maintaining zinc homeostasis in changing conditions.

How is Zhf1 function integrated with other zinc homeostasis mechanisms in S. pombe?

Zhf1 operates within a coordinated network of zinc homeostasis proteins:

ProteinPrimary FunctionRegulationInteraction with Zhf1
Zrt1High-affinity zinc uptakeRepressed by Loz1 in high zincComplementary function to Zhf1; more sensitive in zhf1Δ background
Loz1Zinc-dependent transcriptional repressorActive in high zincRepresses genes like zrt1 when Zhf1 is functioning normally
Zip2Potential zinc mobilization from ERUnknownMay mobilize zinc stored by Zhf1 during deficiency
Adh1/Adh4Zinc-dependent alcohol dehydrogenasesRegulated by Loz1Represent downstream targets affected by Zhf1-mediated zinc availability

This integrated system allows S. pombe to: (1) uptake zinc when needed, (2) store excess zinc to prevent toxicity, (3) release stored zinc during deficiency, and (4) regulate gene expression according to zinc status .

What experimental methods are commonly used to measure Zhf1 activity?

Several complementary approaches can be employed to assess Zhf1 function:

  • Growth assays: Comparing growth of wild-type and zhf1Δ strains across a range of zinc concentrations (2 μM to several mM) to establish zinc tolerance profiles

  • Elemental profiling: Using ICP-OES (Inductively Coupled Plasma Optical Emission Spectrometry) to measure total cellular zinc content and other metals

  • Radioisotope uptake: Measuring ⁶⁵Zn²⁺ accumulation to quantify zinc transport capabilities

  • Gene expression analysis: Monitoring zrt1 and other zinc-responsive genes as indirect indicators of cytosolic zinc status

  • Protein abundance measurement: Using epitope-tagged Zhf1 constructs to track protein levels under different zinc conditions

When designing experiments, it's important to control zinc levels precisely, often using zinc-limited media with specific zinc supplementation to create reproducible conditions.

What phenotypic changes are observed in zhf1-deficient S. pombe strains?

Cells lacking Zhf1 display several distinctive phenotypes:

  • Growth restriction: Severely reduced growth in high zinc environments due to inability to detoxify excess zinc

  • Hypersensitivity to zinc fluctuations: Loss of growth capability when zinc levels change rapidly

  • Altered gene expression profile: Constitutive expression of zinc deficiency response genes even in moderate zinc conditions

  • Increased zinc uptake: Enhanced short-term zinc accumulation due to derepression of uptake systems

  • Metabolic adjustments: Changes in expression of genes involved in carbohydrate metabolism and alcohol fermentation pathways

These phenotypes highlight Zhf1's essential role in zinc homeostasis and reveal the cellular consequences when zinc detoxification mechanisms fail.

What strategies are most effective for expressing and purifying recombinant Zhf1 for in vitro studies?

Successful expression and purification of recombinant Zhf1 requires specialized approaches for membrane proteins:

Expression strategy:

  • Expression system selection: Use either homologous expression in S. pombe or heterologous expression in systems like Pichia pastoris that handle membrane proteins well

  • Construct design: Create an expression vector with:

    • A strong but controllable promoter (e.g., nmt1 promoter for S. pombe)

    • C-terminal affinity tag (His6 or TAP tag) to avoid disrupting the N-terminal signal sequence

    • Optional GFP fusion to monitor expression and localization

  • Induction conditions: Optimize zinc concentration during expression, as high zinc might affect protein folding

Purification protocol:

  • Membrane fraction isolation using ultracentrifugation (100,000×g)

  • Solubilization with mild detergents (DDM or LMNG often effective for transporters)

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography for final purification

Validation methods:

  • Western blotting to confirm protein integrity

  • Zinc binding assays to verify function

  • Reconstitution into liposomes for transport studies

This approach has been successful for related transporters and should yield functional Zhf1 for biochemical and structural studies.

How does the Loz1 transcription factor interact with Zhf1 function, and what experimental designs can elucidate this relationship?

The Loz1 transcription factor and Zhf1 transporter function in the same zinc homeostasis pathway but at different regulatory levels:

Relationship mechanism:

  • Loz1 acts as a transcriptional repressor in high zinc conditions, controlling the expression of zinc uptake genes like zrt1

  • Zhf1 physically transports excess zinc into the ER, reducing cytosolic zinc levels

  • In zhf1Δ strains, Loz1-mediated repression becomes hypersensitive to external zinc (approximately 100-fold)

Experimental approach to study this relationship:

  • Genetic approach: Create loz1Δ zhf1Δ double mutants and compare zinc sensitivity to single mutants

  • Transcriptional analysis: Use RNA-seq to identify the complete set of genes regulated by:

    • Loz1 alone (comparing wild-type vs. loz1Δ)

    • Zhf1 alone (comparing wild-type vs. zhf1Δ)

    • Both factors (using double mutants)

  • ChIP-seq analysis: Map Loz1 binding sites across the genome in both wild-type and zhf1Δ backgrounds

  • Zinc-dependent reporter assays: Construct reporters driven by Loz1 target promoters and measure activity across zinc concentrations in both wild-type and zhf1Δ backgrounds

This approach would reveal how cytosolic zinc levels maintained by Zhf1 influence Loz1 function and the broader zinc-responsive transcriptional network.

What are the most reliable methods for measuring subcellular zinc distribution in wild-type versus zhf1Δ S. pombe cells?

Accurately measuring zinc distribution between cellular compartments requires specialized techniques:

Genetically-encoded zinc sensors:

  • Transform cells with constructs expressing zinc-responsive fluorescent proteins (e.g., FRET-based sensors) targeted to specific compartments (cytosol, ER, Golgi)

  • Measure zinc-dependent changes in fluorescence using confocal microscopy

  • Compare zinc distribution patterns between wild-type and zhf1Δ cells

Organelle fractionation approach:

  • Isolate subcellular fractions (cytosol, ER, Golgi, vacuole) using differential centrifugation

  • Verify fraction purity using compartment-specific marker proteins

  • Determine zinc content in each fraction using ICP-MS

  • Compare the distribution profiles between wild-type and zhf1Δ strains

Fluorescent zinc probes:

  • Incubate cells with membrane-permeable zinc-specific fluorescent probes (e.g., FluoZin-3 AM)

  • Use colocalization with organelle-specific markers to determine zinc distribution

  • Perform time-course experiments after zinc addition/removal

The most informative approach combines these methods to overcome the limitations of each individual technique, providing a comprehensive view of how Zhf1 influences zinc compartmentalization.

How can CRISPR-Cas9 genome editing be optimized for studying Zhf1 function in S. pombe?

CRISPR-Cas9 offers powerful approaches for zhf1 manipulation in S. pombe:

Protocol optimization:

  • Guide RNA design:

    • Select targets with minimal off-target effects

    • For zhf1, target conserved regions encoding transmembrane domains or zinc-binding sites

    • Use S. pombe-specific algorithms for sgRNA design

  • Delivery method:

    • Optimize transformation protocol using lithium acetate/PEG method

    • Use ribonucleoprotein (RNP) complexes rather than plasmid-based expression

    • Include positive selection marker (e.g., G418 resistance)

  • Repair templates:

    • Design homology-directed repair templates with:

      • 500-1000 bp homology arms

      • Desired mutations (point mutations, epitope tags, or fluorescent protein fusions)

      • Silent mutations in the PAM site to prevent re-cutting

Experimental applications:

  • Create precise point mutations in putative zinc-binding domains

  • Generate fluorescent protein fusions for localization studies

  • Introduce regulatory element modifications to study transcriptional control

  • Develop conditional alleles using auxin-inducible degron system

This approach allows for sophisticated genetic manipulations that traditional methods cannot achieve, providing new insights into Zhf1 structure-function relationships.

What statistical approaches should be used when analyzing zinc flux data from zhf1 mutant experiments?

Analyzing zinc transport data requires specialized statistical approaches:

Experimental design considerations:

  • Include biological replicates (n≥3) and technical replicates (n≥3)

  • Incorporate appropriate controls (wild-type, known zinc transport mutants)

  • Design factorial experiments to test multiple variables (zinc concentration, time, pH)

Statistical analysis framework:

  • Data preprocessing:

    • Normalize to account for differences in cell number/protein content

    • Apply appropriate transformations if data is not normally distributed

    • Identify and address outliers using established criteria

  • Primary statistical tests:

    • Two-way ANOVA to assess effects of genotype and zinc concentration

    • Repeated measures ANOVA for time-course experiments

    • Post-hoc tests (Tukey's HSD) to identify specific significant differences

  • Advanced modeling:

    • Michaelis-Menten kinetics to determine transport parameters (Vmax, Km)

    • Compartmental modeling for tracking zinc movement between cellular compartments

    • Bayesian approaches for integrating prior knowledge with experimental data

  • Visualization:

    • Create plots showing zinc uptake/efflux rates as functions of concentration and time

    • Generate heat maps for visualizing patterns across multiple experimental conditions

How can conflicting data about Zhf1 function be reconciled through experimental design?

When facing contradictory findings about Zhf1 function, systematic approaches can resolve discrepancies:

Root causes of data conflicts:

  • Differences in strain backgrounds

  • Variations in media composition and zinc levels

  • Distinctions between acute vs. chronic zinc exposure

  • Differences in experimental methods and sensitivity

Resolution strategy:

  • Standardization experiment:

    • Use identical strains across laboratories

    • Develop standardized media with defined zinc levels

    • Establish common protocols for zinc treatment and measurement

  • Multifactorial experimental design:

    • Test multiple variables simultaneously (strain, media, zinc level, exposure time)

    • Use factorial design to identify interaction effects

    • Apply principal component analysis to identify key variables driving differences

  • Method comparison study:

    • Apply multiple techniques to measure the same parameter

    • Systematically compare sensitivity and reliability

    • Develop calibration factors between different methods

  • Genetic interaction mapping:

    • Create double mutants between zhf1 and other zinc homeostasis genes

    • Identify epistatic relationships to place Zhf1 in the correct pathway context

    • Use synthetic genetic array (SGA) analysis for genome-wide interaction screening

This systematic approach can reconcile apparently contradictory data and develop a unified model of Zhf1 function in zinc homeostasis.

What bioinformatic approaches can predict Zhf1 structure and function?

Computational methods provide valuable insights into Zhf1 structure and function:

Structural prediction pipeline:

  • Sequence analysis:

    • Multiple sequence alignment with CDF family transporters

    • Identification of conserved motifs and potential metal-binding sites

    • Transmembrane topology prediction using specialized algorithms (TMHMM, Phobius)

  • Structure prediction:

    • Template-based modeling using known CDF transporter structures

    • Ab initio modeling for regions without templates

    • Molecular dynamics simulations to assess stability and conformational changes

  • Functional site prediction:

    • Identify potential zinc-binding residues using metal-binding site predictors

    • Predict posttranslational modification sites that might regulate activity

    • Identify potential protein-protein interaction interfaces

  • Validation approaches:

    • Compare predictions with experimental data from related transporters

    • Design targeted mutations to test predicted functional sites

    • Use docking simulations to model zinc interaction with the predicted binding sites

This integrated bioinformatic approach generates testable hypotheses about Zhf1 structure-function relationships that can guide experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.