Recombinant Sciurus carolinensis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will ship the available format. If you require a specific format, please specify this during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: Proteins are shipped with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Sciurus carolinensis (Gray squirrel)
Target Names
Target Protein Sequence
MTNIRKTHPLLKIVNHSFIDLPAPSNISAWWNFGSLLGLCLLIQILTGLFLAMHYTSDTM TAFSSVTHICRDVNYGWLIRYMHANGASLFFICLFLHVGRGLYYGSYTYFETWNIGVILL FAVMATAFMGYVLPWGQMSFWGATVITNHLSAIPYIGTTLVEWIWGGFSVDKATLT
Uniprot No.

Target Background

Function

A component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane, essential for ATP synthesis.

Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Sciurus carolinensis Cytochrome b and what is its role in mitochondrial function?

Cytochrome b is an integral membrane protein found in the inner mitochondrial membrane of Sciurus carolinensis (Eastern gray squirrel). It functions as a critical component of respiratory chain complex III (ubiquinol-cytochrome c reductase), participating in electron transport and proton pumping to generate the proton-motive force necessary for ATP synthesis. The protein consists of approximately 400 amino acid residues with multiple transmembrane segments and binds two heme groups (b562 and b566) that are essential for electron transfer . In S. carolinensis, cytochrome b is encoded by the mitochondrial MT-CYB gene and represents one of the most frequently studied mitochondrial markers due to its sequence variability and conserved functional domains.

The protein plays a dual role in both bioenergetics and evolutionary biology. From a functional perspective, it facilitates electron transfer within the respiratory chain, while from an evolutionary standpoint, its sequence variability makes it invaluable for phylogenetic studies, particularly for resolving relationships within families and genera . Studies have identified at least 16 distinct cytochrome b haplotypes among S. carolinensis populations, reflecting the genetic diversity within this species .

Why is recombinant production of S. carolinensis MT-CYB valuable for research?

Recombinant production of S. carolinensis cytochrome b provides researchers with several significant advantages over native protein isolation. First, it allows for controlled expression of specific variants, enabling comparative studies of different haplotypes identified in wild populations. Given that researchers have detected 16 distinct cytochrome b haplotypes among S. carolinensis specimens , recombinant expression systems facilitate the production of these variants in quantities sufficient for detailed structural and functional analysis.

Second, recombinant approaches permit site-directed mutagenesis experiments to investigate the functional significance of specific amino acid residues, particularly those that may be involved in heme binding. As cytochrome b non-covalently binds two heme groups through conserved histidine residues , recombinant systems allow researchers to introduce mutations at these positions to evaluate their impact on protein stability and electron transfer capabilities.

Third, recombinant expression provides a renewable source of protein for structural studies, including crystallography and molecular dynamics simulations, which can provide insights into the protein's tertiary structure and folding patterns. These approaches have been successfully employed to model cytochrome b structure and predict the effects of mutations, as demonstrated in studies of human MT-CYB mutations associated with cardiomyopathy .

How does S. carolinensis MT-CYB compare to cytochrome b in other species?

Phylogenetic studies using cytochrome b sequences have helped resolve relationships within the Sciuridae family. For example, analysis of cytochrome b gene sequences revealed phylogenetic relationships among Mesoamerican tree squirrels, demonstrating the monophyly of South American species and recovering a Mesoamerican clade including Sciurus aureogaster, S. granatensis, and S. variegatoides . These studies also highlighted the polyphyletic nature of the genus Microsciurus and the paraphyletic status of Syntheosciurus .

In contrast to other squirrel species like Sciurus niger (fox squirrel), S. carolinensis cytochrome b shows distinct evolutionary patterns. While both species exhibit high haplotype diversity, they differ in their phylogeographic structure. S. niger shows evidence of rapid post-glaciation range expansion and limited geographic structuring , a pattern that provides an interesting comparative framework for investigating S. carolinensis evolution.

What expression systems are optimal for producing recombinant S. carolinensis MT-CYB?

For successful recombinant expression of S. carolinensis cytochrome b, researchers must carefully select an expression system that accommodates the protein's hydrophobic nature and complex folding requirements. The most effective expression systems for membrane proteins like cytochrome b include:

  • Bacterial systems (E. coli): While challenging due to the membrane-associated nature of cytochrome b, E. coli systems can be optimized using specialized strains (C41, C43) designed for membrane protein expression. Success typically requires fusion tags (such as MBP or SUMO) to enhance solubility and specialized vectors with tunable promoters to control expression rates.

  • Yeast expression systems (P. pastoris): These offer advantages for mitochondrial proteins, as yeast possesses mitochondria with machinery for proper folding and heme incorporation. The inducible AOX1 promoter allows controlled expression, while the secretory pathway can be exploited for improved yield.

  • Insect cell systems: Baculovirus-infected insect cells provide eukaryotic processing capabilities with high expression levels, particularly valuable for obtaining properly folded cytochrome b with correct post-translational modifications.

  • Cell-free systems: These allow direct manipulation of the reaction environment and can be supplemented with detergents or membrane mimetics to facilitate proper folding of transmembrane segments.

Experimental evidence suggests that expression conditions must be optimized to include appropriate heme precursors, as cytochrome b non-covalently binds two heme groups (b562 and b566) that are essential for its function . Regardless of the chosen system, expression should be validated through spectroscopic analysis to confirm proper heme incorporation, as indicated by characteristic absorption peaks.

What purification strategies yield the highest purity and activity for recombinant MT-CYB?

Purification of recombinant S. carolinensis cytochrome b presents significant challenges due to its hydrophobic nature and multiple transmembrane segments. The following multi-step purification strategy maximizes both purity and functional activity:

Table 1: Recommended Purification Strategy for Recombinant S. carolinensis MT-CYB

StepMethodPurposeCritical Parameters
1Membrane isolationSeparation of membrane fractionBuffer pH 7.2-7.4, protease inhibitors
2Detergent solubilizationExtraction from membraneDDM or LMNG at 1-2% (w/v)
3Affinity chromatographyInitial purificationImidazole gradient 20-250 mM
4Ion exchange chromatographyRemoval of contaminantsSalt gradient 50-500 mM NaCl
5Size exclusion chromatographyFinal polishing, buffer exchangeFlow rate ≤0.5 mL/min

Throughout the purification process, spectroscopic analysis should monitor the integrity of heme groups, as their presence is essential for cytochrome b function. The heme groups are key parts of the internal electron transfer pathway and indispensable to the proper functioning of quinol oxidizing complexes . UV-visible spectroscopy can confirm the characteristic absorption peaks of properly folded cytochrome b (Soret band at approximately 414 nm and Q-bands between 500-600 nm).

Additionally, researchers should assess protein stability in various detergent and buffer conditions. Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LMNG (lauryl maltose neopentyl glycol) at concentrations just above their critical micelle concentration typically yield the best results for maintaining both structural integrity and functional activity of cytochrome b.

What are the key considerations when designing primers for S. carolinensis MT-CYB amplification?

Designing effective primers for S. carolinensis cytochrome b amplification requires careful consideration of several factors to ensure specificity, efficiency, and comprehensive coverage. Based on established protocols in phylogenetic studies of sciurid rodents, researchers should follow these methodological guidelines:

  • Primer positioning: Target conserved regions flanking the complete MT-CYB gene. Primers H15910 and L14724 have been successfully employed in related squirrel species studies to amplify a region of approximately 1144bp from the mitochondrial cytochrome b gene .

  • Specificity checks: Conduct in silico analysis against potential nuclear mitochondrial DNA segments (NUMTs) that may co-amplify with authentic mitochondrial sequences. This is particularly important as NUMTs can confound phylogenetic analyses.

  • Handling heteroplasmy: Design primers that can detect potential heteroplasmic variants. Quantification of heteroplasmic levels can be accomplished using pyrosequencing, as demonstrated in studies of MT-CYB mutations .

  • Optimization of reaction conditions: PCR reactions for cytochrome b amplification have been successfully performed at annealing temperatures of 60°C, using standard reaction volumes (25μL) containing template DNA (1μL) and appropriate MgCl₂ concentrations (2.5mM) .

  • Verification strategy: Plan for sequencing verification using established methods such as BigDye Terminator Cycle Resequencing and analysis on automated DNA analyzers, with subsequent alignment to reference sequences using software like Sequencher .

When working with historical or degraded samples, researchers should design multiple primer pairs that amplify shorter overlapping fragments (200-300bp) to increase success rates. This approach has proven effective in recovering complete cytochrome b sequences from museum specimens and non-invasive samples.

How reliable is S. carolinensis MT-CYB for resolving phylogenetic relationships compared to other markers?

Cytochrome b has established itself as a valuable marker for phylogenetic analyses, particularly at the genus and species levels. For S. carolinensis research, MT-CYB offers several advantages while also presenting certain limitations that researchers must consider:

Cytochrome b exhibits an intermediate rate of evolution that makes it particularly suitable for resolving relationships within families and genera . This characteristic has made it a preferred marker for squirrel phylogenetics, where it has successfully clarified relationships among Sciurus species. For example, single locus phylogenetic reconstruction using cytochrome B gene sequences has provided insights into the evolutionary relationships of Mesoamerican tree squirrels, supporting the monophyly of South American species and recovering distinct Mesoamerican clades .

The variable regions within cytochrome b make it especially useful for phylogeographic studies, allowing researchers to detect population structure and recent evolutionary events. This application is demonstrated in studies of S. carolinensis and S. niger, where cytochrome b analyses have revealed patterns of post-glacial range expansion .

What does MT-CYB data reveal about the phylogeographic structure of S. carolinensis populations?

Analysis of cytochrome b sequences from S. carolinensis populations has provided valuable insights into the species' phylogeographic patterns, revealing both historical demographic processes and contemporary population structure:

Researchers have identified 16 distinct cytochrome b haplotypes among S. carolinensis populations , indicating substantial genetic diversity within the species. This diversity likely reflects the species' evolutionary history, including possible isolation in glacial refugia followed by range expansion.

Unlike some closely related species, S. carolinensis shows evidence of phylogeographic structure in its mitochondrial DNA. This contrasts with findings in Sciurus niger, which exhibits a general lack of phylogeographic structure attributed to rapid post-glaciation range expansion and phenotypic divergence . These comparative patterns suggest different historical demographic processes between these sympatric squirrel species.

Molecular dating analyses using BEAST (Bayesian Evolutionary Analysis Sampling Trees) chronograms can estimate coalescence times for S. carolinensis haplotypes, providing insights into the timing of population divergence events. Similar analyses in S. niger have estimated that sampled haplotypes coalesce on a common ancestor approximately 33.3-91 thousand years ago , and such approaches could be applied to S. carolinensis data to understand its evolutionary timeline.

How can researchers integrate MT-CYB data with other genetic markers for comprehensive phylogenetic analysis?

Integration of cytochrome b data with other genetic markers requires methodical approaches to resolve potential discordances and generate robust phylogenetic reconstructions. Researchers studying S. carolinensis should implement the following strategies:

  • Multilocus concatenation approach: Combining cytochrome b sequences with nuclear markers provides complementary evolutionary signals. Studies of sciurid phylogenetics have successfully employed this approach, combining MT-CYB with nuclear genes such as IRBP, 12S rDNA, and 16S rDNA . When working with S. carolinensis, researchers should prioritize markers that have previously demonstrated utility in sciurid phylogenetics.

  • Bayesian multispecies coalescent models: These models account for gene tree discordance due to incomplete lineage sorting. Implementation in software packages like BEAST allows for the integration of multiple loci while accommodating their potentially different evolutionary histories . For S. carolinensis studies, MCMC runs should be conducted with sufficient length (e.g., 100 million generations) and appropriate sampling intervals to ensure convergence.

  • Data partitioning strategies: Separate evolutionary models should be applied to different gene regions or codon positions. For cytochrome b analysis, partitioning by codon position typically provides the best fit, as demonstrated in phylogenetic studies of sciurid rodents . Model selection tools like PartitionFinder can identify the optimal partitioning scheme.

  • Assessment of congruence: Researchers should explicitly test for congruence between cytochrome b and nuclear gene phylogenies. Incongruence may reflect biological processes such as introgression or incomplete lineage sorting, rather than methodological artifacts. Statistical tests like the Incongruence Length Difference (ILD) test can quantify the significance of observed discordances.

  • Evaluation of combined data quality: The completeness and quality of the combined dataset significantly impact phylogenetic resolution. As observed in sciurid studies, datasets with substantial missing data may fail to resolve novel phylogenetic relationships with high statistical support . Researchers should therefore prioritize completeness when selecting markers to combine with cytochrome b.

What computational methods are most effective for predicting S. carolinensis MT-CYB structure?

Predicting the structure of S. carolinensis cytochrome b requires sophisticated computational approaches that account for its membrane-embedded nature and complex interactions with other respiratory chain components. Based on established methodologies in mitochondrial protein research, the following computational pipeline is recommended:

  • Homology modeling: Since the direct crystal structure of S. carolinensis complex III has not been solved, researchers should employ homology-based structural prediction services such as I-TASSER to generate initial models by submitting the S. carolinensis cytochrome b sequence . These models can then be aligned with available crystal structures of cytochrome bc1 complexes from related organisms, such as the bovine mitochondrial cytochrome bc1 complex (PDB ID: 1ntz) .

  • Energy minimization and force field analysis: Once preliminary models are generated, researchers should refine them using energy minimization protocols implemented in software like Swiss-PDB Viewer. This should be followed by analysis using established force fields such as GROMOS 43B1 to evaluate energetic stability and identify potential hydrogen bonding networks .

  • Molecular dynamics simulations: To assess dynamic properties and conformational flexibility, molecular dynamics simulations should be performed using programs like NAMD with appropriate force fields such as CHARMM22 . Simulations should be conducted on water-dissolved protein models under physiologically relevant conditions (e.g., constant temperature of 310K), running for sufficient duration (10-20 nanoseconds) to capture meaningful conformational changes .

  • Secondary structure prediction and analysis: Tools like STRIDE can generate protein secondary structure predictions from molecular dynamics trajectories, providing insights into stable structural elements and regions of flexibility . These predictions are particularly valuable for identifying conserved structural motifs that may be functionally significant.

  • Validation through comparative analysis: Computational predictions should be validated through comparison with experimentally determined structures of cytochrome b from related species. Particular attention should be paid to the conservation of key functional elements, such as the heme-binding regions and transmembrane domains.

How do mutations in MT-CYB affect protein structure and function?

Mutations in cytochrome b can significantly impact protein structure and function, with consequences ranging from subtle energetic inefficiencies to complete loss of activity. Based on molecular modeling and simulation studies, several mechanisms have been identified:

Computational approaches including molecular dynamics simulations are particularly valuable for predicting these structural and functional consequences. When analyzing novel S. carolinensis cytochrome b variants, researchers should employ similar methodologies to those used in human MT-CYB mutation studies, including energy minimization, force field analysis, and trajectory analysis using tools like VMD and STRIDE .

What experimental approaches can link MT-CYB sequence variations to functional consequences?

To establish causal relationships between cytochrome b sequence variations and functional outcomes, researchers should implement a comprehensive experimental strategy that integrates biochemical, biophysical, and cellular approaches:

Table 2: Experimental Approaches for Functional Characterization of MT-CYB Variants

When implementing these approaches, researchers should prioritize comparative analysis between wild-type S. carolinensis cytochrome b and variants of interest, including naturally occurring haplotypes identified in population studies and experimentally generated mutants targeting conserved functional residues.

For cell-based functional studies, researchers can express recombinant S. carolinensis cytochrome b variants in model systems with disrupted endogenous CYTB expression. Complementation efficiency can be assessed through measurements of respiratory chain activity, reactive oxygen species production, and cellular growth under conditions requiring mitochondrial respiration.

The integration of computational predictions with experimental validation provides the most robust approach for characterizing the functional consequences of cytochrome b variants. Molecular dynamics simulations that predict specific structural perturbations should guide the design of targeted biochemical assays to confirm the predicted functional impacts.

How can S. carolinensis MT-CYB studies inform our understanding of mammalian mitochondrial evolution?

Comparative studies of S. carolinensis cytochrome b provide valuable insights into mammalian mitochondrial evolution, revealing patterns of selection and adaptation across evolutionary time. This research has several important applications:

Cytochrome b sequences from S. carolinensis and related species have been instrumental in reconstructing phylogenetic relationships within the Sciuridae family . These evolutionary reconstructions reveal the tempo and mode of squirrel diversification, including evidence for rapid post-glaciation range expansion in some species . By comparing substitution rates and patterns across different lineages, researchers can identify periods of accelerated evolution that may correspond to adaptive radiations or responses to environmental changes.

The identification of 16 cytochrome b haplotypes in S. carolinensis populations provides a window into recent evolutionary processes. Analysis of haplotype diversity and distribution can reveal historical demographic events, such as population bottlenecks, range expansions, and secondary contact between previously isolated populations. These patterns can be compared with those observed in sympatric species like S. niger to identify shared or divergent evolutionary histories .

At the molecular level, comparative analysis of cytochrome b sequences across mammalian species helps identify functionally critical residues that have been conserved over evolutionary time. Since cytochrome b plays an essential role in the respiratory chain, with specific domains involved in electron transport and proton pumping , patterns of sequence conservation highlight regions under strong purifying selection. Conversely, sites showing accelerated evolution may represent adaptations to specific ecological niches or metabolic demands.

The analysis of selection pressures acting on cytochrome b can be particularly informative. By calculating the ratio of nonsynonymous to synonymous substitutions (dN/dS) across different lineages and functional domains, researchers can identify regions of the protein experiencing different selection regimes. This approach has been successfully applied in studies of other mitochondrial genes and can reveal how evolutionary forces have shaped cytochrome b function across mammalian evolution.

What insights can be gained from comparing S. carolinensis MT-CYB with other sciurid species?

Comparative analysis of cytochrome b across sciurid species reveals important evolutionary patterns and provides insights into the genetic basis of adaptation and speciation within this diverse family. Research has highlighted several key findings:

Studies comparing cytochrome b sequences among sciurid species have helped resolve taxonomic relationships and clarify evolutionary histories. For example, phylogenetic analyses have confirmed the monophyly of South American Sciurus species while identifying a distinct Mesoamerican clade including S. aureogaster, S. granatensis, and S. variegatoides . These molecular phylogenies have sometimes contradicted traditional classifications based on morphology, leading to taxonomic revisions.

Comparative studies have revealed interesting patterns in the evolutionary history of the Sciurus genus. Analysis of cytochrome b and other genetic markers has demonstrated the polyphyletic nature of the genus Microsciurus and the paraphyletic status of Syntheosciurus . These findings highlight the complex evolutionary history of sciurid rodents and underscore the value of molecular markers in resolving taxonomic uncertainties.

Different sciurid species show varying patterns of phylogeographic structure in their cytochrome b sequences. While S. niger exhibits a general lack of phylogeographic structure, attributed to rapid post-glaciation range expansion , other species like S. variegatoides show more pronounced geographic patterns with distinct subspecies forming sister taxa in cytochrome b gene trees . By comparing these patterns across species, researchers can identify shared historical processes or divergent responses to past climate changes.

The rate of cytochrome b evolution may vary across sciurid lineages, reflecting differences in generation time, population size, or selective pressures. Comparative analysis of substitution rates can identify lineages with accelerated or decelerated evolutionary rates, potentially correlating with ecological or life-history traits.

How do phylogeographic patterns in S. carolinensis MT-CYB compare with other genetic markers?

The integration of cytochrome b data with other genetic markers provides a more comprehensive understanding of S. carolinensis evolutionary history and reveals important insights about marker-specific evolutionary dynamics:

In sciurid studies, researchers have found that combining multiple genetic markers provides more robust phylogenetic reconstructions than relying on cytochrome b alone. For example, multilocus analyses incorporating both mitochondrial genes (like cytochrome b) and nuclear markers have helped resolve relationships that remained ambiguous in single-gene studies . This highlights the importance of a multi-marker approach for comprehensive evolutionary studies.

The combination of cytochrome b with other mitochondrial regions, such as the D-loop (control region), can be particularly informative. While cytochrome b evolves at an intermediate rate suitable for species-level phylogenetics, the D-loop is the most rapidly evolving portion of the mitochondrial genome and can provide higher resolution for recent evolutionary events . Studies in S. niger have successfully combined these markers to investigate phylogeographic structure and historical demographic processes , and similar approaches would be valuable for S. carolinensis research.

When comparing cytochrome b with nuclear markers, it's important to consider potential discordances due to incomplete lineage sorting, introgression, or selection. These processes can lead to conflicting phylogenetic signals between mitochondrial and nuclear genes. Bayesian multispecies coalescent models provide a framework for integrating these potentially discordant signals into a coherent evolutionary narrative .

What are common challenges in working with recombinant MT-CYB and how can they be overcome?

Researchers working with recombinant S. carolinensis cytochrome b face several significant challenges that require specific methodological solutions:

Challenge 1: Low expression levels and inclusion body formation
Cytochrome b's hydrophobic nature often leads to aggregation and inclusion body formation when expressed in bacterial systems. To overcome this:

  • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Lower expression temperature (16-20°C) to slow protein synthesis and improve folding

  • Co-express molecular chaperones (GroEL/GroES) to assist proper folding

  • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Explore cell-free expression systems supplemented with detergents or lipid nanodiscs

Challenge 2: Improper heme incorporation
Cytochrome b requires proper incorporation of two heme groups for functional activity . Strategies to address this challenge include:

  • Supplement expression media with δ-aminolevulinic acid to boost heme biosynthesis

  • Consider expression in eukaryotic systems with endogenous heme biosynthetic pathways

  • Implement a heme reconstitution step during protein purification

  • Verify proper heme incorporation using UV-visible spectroscopy to identify characteristic absorption peaks

Challenge 3: Protein instability during purification
The multi-transmembrane structure of cytochrome b makes it prone to denaturation during purification:

  • Screen multiple detergents to identify optimal solubilization conditions

  • Maintain a consistent detergent concentration above CMC throughout purification

  • Include stabilizing agents such as glycerol (10-20%) in all buffers

  • Consider lipid supplementation to maintain a native-like membrane environment

  • Minimize exposure to extreme temperatures, pH, or ionic strength

  • Conduct purification steps rapidly and maintain samples at 4°C

Challenge 4: Difficult functional characterization
Assessing functional activity of isolated cytochrome b is challenging since it normally functions as part of Complex III:

  • Reconstitute purified protein into liposomes or nanodiscs to provide a membrane environment

  • Develop spectroscopic assays that can detect electron transfer capability

  • Consider co-expression with minimal Complex III components necessary for activity

  • Implement complementation assays in cytochrome b-deficient cell lines or yeast strains

How can researchers address heteroplasmy when analyzing MT-CYB sequences?

Heteroplasmy—the presence of multiple mitochondrial DNA variants within a single individual—presents significant challenges for cytochrome b sequence analysis. Researchers studying S. carolinensis MT-CYB should implement the following methodological approaches:

  • Detection strategies: Standard Sanger sequencing may miss low-level heteroplasmy, appearing as background noise in chromatograms. More sensitive approaches include:

    • Pyrosequencing, which has been successfully used to quantify heteroplasmic levels in MT-CYB mutations

    • Next-generation sequencing with high depth of coverage (>1000x) to detect variants present at frequencies as low as 1%

    • Digital droplet PCR for precise quantification of specific heteroplasmic variants

  • Tissue-specific sampling: Heteroplasmy levels can vary significantly between tissues due to mitotic segregation and tissue-specific selection. When possible, researchers should:

    • Sample multiple tissues from the same individual

    • Consider enriching for mitochondria-dense tissues for higher mtDNA yields

    • Document tissue source meticulously when reporting heteroplasmy data

  • Quantification methods: Accurate quantification of heteroplasmy requires appropriate methodological approaches:

    • For known variants, pyrosequencing assays can be designed using software like PyroMark Assay Design Software

    • For exploratory studies, deep sequencing followed by robust bioinformatic analysis is recommended

    • Establish detection thresholds based on technical controls to distinguish true heteroplasmy from sequencing errors

  • Data interpretation: When heteroplasmy is detected, researchers should:

    • Report both the major and minor variants and their relative frequencies

    • Consider the potential functional implications of heteroplasmic variants

    • Analyze heteroplasmy patterns across maternal lineages to assess inheritance patterns

    • Evaluate whether heteroplasmic variants might represent nuclear mitochondrial DNA segments (NUMTs)

  • Maternal lineage analysis: Tracing heteroplasmy through maternal lineages can provide valuable insights:

    • Analyze maternal relatives when available to track inheritance patterns

    • Document changes in heteroplasmy levels across generations

    • Consider the possibility of purifying selection acting on deleterious variants

What controls are essential when using recombinant MT-CYB in functional assays?

Robust experimental design for functional characterization of recombinant S. carolinensis cytochrome b requires comprehensive controls to ensure reliable and interpretable results:

Table 3: Essential Controls for MT-CYB Functional Assays

Control TypePurposeImplementationInterpretation
Negative controlEstablish baseline activityEmpty vector expressionAny activity above this level represents recombinant protein function
Positive controlVerify assay functionalityKnown functional cytochrome b (e.g., bovine)Confirms assay can detect activity when present
Heme-free controlAssess heme contributionExpression without heme supplementationQuantifies dependency on proper heme incorporation
Denatured proteinControl for non-specific effectsHeat-treated recombinant proteinEnsures measured activity requires native protein structure
Site-directed mutantsValidate structure-function relationshipsMutations at conserved residuesConfirms specific functional domains and mechanisms

Beyond these basic controls, researchers should implement assay-specific quality control measures:

  • For spectroscopic assays: Include controls for spectral interference from buffer components and baseline drift over time. Perform wavelength scans rather than single-wavelength measurements to identify characteristic spectral features of properly folded cytochrome b.

  • For complex III activity assays: Include inhibitor controls using known complex III inhibitors (e.g., antimycin A, myxothiazol) at concentrations that should completely abolish activity. This confirms the specificity of the measured activity.

  • For cellular complementation assays: Include both positive controls (cells with functional native cytochrome b) and negative controls (cytochrome b-deficient cells without complementation). Additionally, include controls for expression levels to account for potential differences in protein abundance.

  • For protein-protein interaction studies: Include controls for non-specific binding using unrelated proteins of similar size and charge characteristics. For co-immunoprecipitation experiments, include controls using non-specific antibodies or pre-immune serum.

  • For stability studies: Include reference proteins with known stability profiles to benchmark results. Time-course studies should include multiple timepoints to capture the kinetics of potential degradation or activity loss.

Proper documentation of all control experiments is essential for publication, as is detailed reporting of experimental conditions, including temperature, pH, ionic strength, and the presence of detergents or lipids that might affect cytochrome b function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.