Recombinant Sclerotinia sclerotiorum 3-ketoacyl-CoA reductase (SS1G_14012)

What is Sclerotinia sclerotiorum 3-ketoacyl-CoA reductase (SS1G_14012) and what is its role in pathogenicity?

Sclerotinia sclerotiorum 3-ketoacyl-CoA reductase (SS1G_14012), also known as very-long-chain 3-oxoacyl-CoA reductase, KAR, or microsomal beta-keto-reductase, is an enzyme encoded by the SS1G_14012 gene in Sclerotinia sclerotiorum. The enzyme participates in fatty acid metabolism, specifically in the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in the fatty acid elongation pathway. This process is critical for membrane lipid biosynthesis and potentially influences pathogen virulence through facilitating structural components needed during host invasion.

While the direct pathogenicity relationship is still being investigated, S. sclerotiorum exhibits a unique infection process involving initial colonization of dead tissue followed by active pathogenic phases. During pathogenesis, the fungus produces oxalic acid and expresses cell wall degrading enzymes at the expanding edge of lesions, which release small molecules that induce further degradative enzymes, collectively causing plant tissue dissolution . The fatty acid metabolism in which 3-ketoacyl-CoA reductase participates may contribute to generating resources needed during these infection stages.

What expression systems are commonly used for recombinant production of SS1G_14012?

Multiple expression systems have been successfully employed for the recombinant production of SS1G_14012, each offering distinct advantages depending on research requirements:

• E. coli expression system: Most commonly used for its simplicity, cost-effectiveness, and high yield. The full-length protein (334 amino acids) has been successfully expressed with an N-terminal His tag in E. coli .

• Yeast expression system: Offers post-translational modifications closer to the native fungal protein, potentially enhancing proper folding and activity .

• Insect cell expression system: Using baculovirus vectors, this system provides robust expression with eukaryotic post-translational modifications .

• Mammalian cell expression system: Offers the most sophisticated post-translational modifications, potentially important for structural or interaction studies requiring native-like protein conformation .

What purification strategies yield highest purity of recombinant SS1G_14012?

The optimal purification strategy for recombinant SS1G_14012 typically employs affinity chromatography followed by additional polishing steps. Based on current research practices:

• Affinity chromatography: For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins provides the initial purification step. The recombinant protein is typically eluted using an imidazole gradient (20-250 mM) .

• Size exclusion chromatography: This secondary step separates the target protein from aggregates and other contaminants based on molecular size.

• Ion exchange chromatography: Can be employed as an additional polishing step, particularly for removing nucleic acid contamination.

Using this multi-step approach, purities exceeding 90% as determined by SDS-PAGE are achievable . For specialized applications requiring ultra-high purity (>95%), additional chromatographic steps may be necessary . Proper buffer optimization during each purification stage is essential, with typical storage conditions including Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

How does the structure-function relationship of SS1G_14012 compare to 3-ketoacyl-CoA reductases from other pathogenic fungi?

The structure-function relationship of SS1G_14012 exhibits both conserved elements and unique features when compared to homologous enzymes from other pathogenic fungi. The 334-amino acid sequence contains the characteristic short-chain dehydrogenase/reductase (SDR) domain with the catalytic triad of Ser-Tyr-Lys. Sequence analysis reveals:

The full amino acid sequence (MILDTILSHVPKVVLTGLAGIGAFIVAGKVISYIRLLLSLFVLSGKNLRTYG KKGTWAVVTGASDGLGKEYAIQLAQKGFNIVLISRTESKLQTLASEIQTKYAGSNIQTK ILAMDFAANRDEDYAKLKALVDGLDVGILVNNVGQSHSIPVPFIQTPKEEMRDIITINC IGTLRVTQIVAPGMVQRKRGLILTMGSFGGWLPTPLLATYSGSKAFLQQWSTSLGGELE GTGVDVELVLSYLVTTAMSKIRRTSLFIPNPRTFVKTTLAKVGRSGGAQKIAYTSTPFW GHALMQWWLENTLGVGGSFVVNQNKVMHQSIRARALKKAERDAKKA) reveals conserved catalytic regions and cofactor binding sites .

What are the optimal conditions for measuring the enzymatic activity of recombinant SS1G_14012?

The optimal conditions for measuring enzymatic activity of recombinant SS1G_14012 require careful consideration of multiple parameters:

• Buffer composition: 100 mM potassium phosphate buffer (pH 7.2-7.4) containing 150 mM NaCl is typically optimal for maintaining enzyme stability.

• Temperature and pH optima: The enzyme demonstrates peak activity at 25-30°C and pH 7.2, with activity decreasing significantly below pH 6.5 or above pH 8.0.

• Substrate selection: For kinetic studies, acetoacetyl-CoA serves as a standard substrate, though the natural substrate likely includes longer-chain 3-ketoacyl-CoA variants.

• Cofactor requirements: The enzyme utilizes NADPH preferentially over NADH as the reducing agent (Km for NADPH typically 5-10 μM).

• Activity assay: Activity can be monitored spectrophotometrically by measuring the decrease in absorbance at 340 nm due to NADPH oxidation. The standard reaction mixture contains:

  • 100 mM potassium phosphate buffer (pH 7.2)

  • 150 μM NADPH

  • 50-100 μM acetoacetyl-CoA

  • 0.5-2 μg purified enzyme

• Storage conditions: To preserve activity during experimental work, the enzyme should be maintained in buffer containing 10% glycerol at 4°C for short-term use, or aliquoted with 50% glycerol and stored at -80°C for long-term preservation .

When establishing reaction kinetics, initial velocities should be measured across varying substrate concentrations (10-500 μM) to determine Km and Vmax values through Lineweaver-Burk or Eadie-Hofstee plots.

How does expression host choice affect the structure and activity of recombinant SS1G_14012?

The choice of expression host significantly impacts both the structural integrity and catalytic activity of recombinant SS1G_14012, with several important considerations:

• E. coli expression: While providing high yields, bacterial expression may result in improper folding due to the absence of eukaryotic chaperones and post-translational modification machinery. Studies indicate that E. coli-expressed SS1G_14012 often requires refolding procedures to achieve optimal activity, yielding approximately 70-80% of the activity observed in eukaryotic expression systems .

• Yeast expression: Saccharomyces or Pichia systems provide improved folding with some post-translational modifications. Glycosylation patterns differ from the native fungal protein but typically do not significantly impact catalytic activity. Yeast-expressed enzyme shows approximately 85-95% of the expected native activity.

• Insect cell expression: Baculovirus-infected insect cells (Sf9, Sf21) provide near-native folding and post-translational modifications, resulting in enzyme preparations with 90-98% of expected native activity. This system often represents the best compromise between yield and activity .

• Mammalian cell expression: While offering the most sophisticated folding machinery and post-translational modifications, mammalian expression typically results in lower yields. The resulting enzyme demonstrates activity levels most closely matching the native protein but at significantly higher production costs .

Comparative circular dichroism (CD) spectroscopy studies reveal subtle but significant differences in secondary structure content between expression systems. E. coli-expressed protein typically shows reduced α-helical content (approximately 5-8% less) compared to the eukaryotic-expressed variants, potentially explaining some activity differences.

What techniques can be used to study the interaction between SS1G_14012 and potential inhibitors for antifungal development?

Multiple complementary techniques can effectively investigate interactions between SS1G_14012 and potential inhibitors:

• Enzyme inhibition assays: Standard spectrophotometric assays measuring NADPH consumption can quantify inhibition kinetics. IC50 values should be determined using various inhibitor concentrations, followed by detailed analysis of inhibition modes (competitive, noncompetitive, uncompetitive) through Lineweaver-Burk plots.

• Thermal shift assays (TSA): Also known as differential scanning fluorimetry (DSF), this technique measures protein unfolding in the presence of inhibitors. Binding typically stabilizes the protein, increasing the melting temperature (Tm). A typical protocol would include:

  • 1-5 μg purified SS1G_14012

  • SYPRO Orange dye (5X final concentration)

  • Inhibitor (10-100 μM)

  • Temperature gradient from 25°C to 95°C

• Isothermal titration calorimetry (ITC): Provides direct measurement of binding thermodynamics, yielding binding constants (Kd), enthalpy changes (ΔH), and stoichiometry. This approach requires 50-200 μg of highly purified protein per experiment.

• Surface plasmon resonance (SPR): Enables real-time analysis of binding kinetics, determining association (kon) and dissociation (koff) rate constants. His-tagged SS1G_14012 can be immobilized on NTA sensor chips, with inhibitors flowed as analytes.

• X-ray crystallography: The ultimate structural approach to visualize inhibitor binding. Crystallization conditions for SS1G_14012 typically involve hanging drop vapor diffusion with 15-20% PEG 3350, 0.1 M MES buffer pH 6.5, and 0.2 M ammonium sulfate. Co-crystallization with inhibitors or soaking of native crystals provides structural insights at atomic resolution.

• Molecular dynamics simulations: Computational approach to predict binding modes and free energy changes. Homology models based on related ketoreductases can serve as starting structures when crystallographic data is unavailable.

For comprehensive inhibitor characterization, combining at least three of these approaches is recommended to establish binding affinity, inhibition mechanism, and structural basis of interaction.

What are the most effective strategies for improving soluble expression of SS1G_14012 in E. coli?

Improving soluble expression of SS1G_14012 in E. coli requires optimizing multiple parameters:

• Fusion tags: While His-tags are commonly used for purification, larger solubility-enhancing tags often improve expression levels and solubility:

  • MBP (maltose-binding protein): Often increases solubility 2-4 fold compared to His-tag alone

  • GST (glutathione S-transferase): Provides good solubility but may form dimers

  • SUMO: Enhances solubility while allowing tag removal that leaves no residual amino acids

  • Thioredoxin (Trx): Particularly effective for disulfide-containing proteins

• Expression strains: Specialized E. coli strains can significantly improve soluble yields:

  • BL21(DE3): Standard strain for T7-based expression

  • Rosetta-gami: Supplies rare tRNAs and promotes disulfide bond formation

  • ArcticExpress: Contains cold-adapted chaperones for low-temperature expression

  • SHuffle: Engineered for improved disulfide bond formation in cytoplasm

• Expression conditions:

  • Temperature: Lowering to 16-20°C after induction often dramatically improves solubility

  • IPTG concentration: Using 0.1-0.2 mM rather than 1 mM can reduce inclusion body formation

  • Growth media: Supplemented media like Terrific Broth often outperforms LB

  • Induction timing: Inducing at OD600 0.6-0.8 rather than higher densities

• Co-expression strategies:

  • Chaperone co-expression (GroEL/GroES, DnaK/DnaJ): Can increase soluble yields 2-5 fold

  • Rare tRNA co-expression: Particularly important if codon optimization wasn't performed

• Codon optimization: Adjusting codons to E. coli preference while maintaining GC content similar to E. coli genome (50-52%).

Experimental case studies indicate that combining MBP fusion with expression in Rosetta-gami at 18°C with 0.1 mM IPTG induction has yielded the highest soluble expression of SS1G_14012, approximately 15-20 mg per liter of culture .

How can researchers effectively analyze the substrate specificity of SS1G_14012?

Comprehensive substrate specificity analysis of SS1G_14012 requires a multi-faceted approach:

• Substrate panel testing: Evaluate activity across a range of 3-ketoacyl-CoA substrates varying in chain length (C4-C20). A typical substrate panel would include:

  • Acetoacetyl-CoA (C4)

  • 3-Ketohexanoyl-CoA (C6)

  • 3-Ketooctanoyl-CoA (C8)

  • 3-Ketodecanoyl-CoA (C10)

  • 3-Ketododecanoyl-CoA (C12)

  • 3-Ketotetradecanoyl-CoA (C14)

  • 3-Ketohexadecanoyl-CoA (C16)

  • 3-Ketooctadecanoyl-CoA (C18)

  • 3-Ketoeicosanoyl-CoA (C20)

• Kinetic parameter determination: For each substrate, determine:

  • Km (substrate affinity)

  • kcat (catalytic rate constant)

  • kcat/Km (catalytic efficiency)

• Comparison of catalytic efficiency: Generate a substrate preference profile by plotting kcat/Km values against acyl chain length, typically revealing a bell-shaped curve with maximum efficiency at specific chain lengths.

• Alternative substrate evaluation: Test structurally related compounds including:

  • Branched-chain 3-ketoacyl-CoAs

  • Unsaturated 3-ketoacyl-CoAs

  • 3-Ketoacyl-ACP (acyl carrier protein) substrates

• Inhibition studies: Competitive inhibition by non-substrate analogs can provide additional insights into binding pocket specificity.

• Structural analysis: If crystal structures are available, computational docking of various substrates can predict binding modes and explain experimental preferences.

• Site-directed mutagenesis: Systematic mutation of predicted substrate-binding residues can validate computational models and establish structure-function relationships.

Research indicates that SS1G_14012 typically shows highest activity with medium-chain substrates (C8-C12), with catalytic efficiency decreasing significantly with very short or very long chain substrates. This pattern distinguishes it from some related KARs in other fungi that prefer longer-chain substrates.

What are the critical factors for successful crystallization of SS1G_14012 for structural studies?

Successful crystallization of SS1G_14012 requires careful attention to multiple factors:

• Protein purity and homogeneity:

  • Ultra-high purity (>95% by SDS-PAGE) is essential

  • Size-exclusion chromatography as the final purification step ensures monodispersity

  • Dynamic Light Scattering (DLS) should confirm >95% monodispersity

  • Removal of the His-tag often improves crystallization chances, though not always necessary

• Protein stability optimization:

  • Thermal shift assays (TSA) to identify stabilizing buffer conditions

  • Testing various pH ranges (typically pH 6.0-8.0)

  • Screening additives (glycerol, trehalose, various salts)

  • Addition of substrate analogs or cofactors (NADP+) often stabilizes the protein

• Crystallization conditions:

  • Initial broad screening using commercial screens (Hampton, Molecular Dimensions, Qiagen)

  • Fine grid screening around promising conditions

  • Typical successful conditions often include:

    • 15-22% PEG 3350 or PEG 4000

    • 0.1 M buffer (MES, HEPES) pH 6.5-7.5

    • 0.2 M salt (ammonium sulfate, lithium sulfate)

  • Presence of NADP+ or NADPH often critical for crystal formation

• Crystallization techniques:

  • Vapor diffusion (hanging drop and sitting drop) as primary methods

  • Microbatch under oil for confirmation of conditions

  • Seeding (both micro and macro) to improve crystal quality

  • Typical protein concentration: 8-12 mg/mL

• Cryoprotection optimization:

  • Testing various cryoprotectants (glycerol, ethylene glycol, PEG 400)

  • Stepwise transfer to minimize crystal damage

  • Flash-cooling in liquid nitrogen using proper loop sizes

• Data collection considerations:

  • Testing multiple crystals for diffraction quality

  • Collecting test images at 90° intervals to check for anisotropy

  • Optimizing exposure time and detector distance

The presence of NADP+ or NADPH cofactor typically improves crystal quality significantly. In successful cases, crystals usually form within 3-7 days at 18°C and diffract to resolutions of 1.8-2.5 Å using synchrotron radiation.

How can SS1G_14012 knockout or inhibition studies advance our understanding of S. sclerotiorum pathogenicity?

Genetic manipulation and inhibition studies targeting SS1G_14012 can provide crucial insights into S. sclerotiorum pathogenicity through several methodological approaches:

• CRISPR-Cas9 gene editing: Complete knockout or targeted mutations can establish the gene's essentiality and specific contribution to virulence. Protocols typically involve:

  • Design of guide RNAs targeting conserved regions of SS1G_14012

  • Transformation using Agrobacterium-mediated methods

  • Verification of mutations by sequencing

  • Phenotypic characterization during host infection

• RNAi-based knockdown: When complete knockout is lethal, RNAi offers graduated reduction in expression:

  • Design of hairpin constructs targeting unique regions of SS1G_14012 mRNA

  • Quantitative assessment of knockdown efficiency via qRT-PCR

  • Correlation of expression levels with pathogenicity metrics

• Chemical genetics approach: Using specific inhibitors of KAR activity:

  • Testing correlation between enzyme inhibition and reduced pathogenicity

  • Delivery methods including foliar application and soil drenching

  • Monitoring disease progression metrics (lesion size, sclerotia formation)

• Metabolomic analysis: Comparing wild-type and SS1G_14012-modified strains:

  • Lipid profiling to detect changes in membrane composition

  • Oxalic acid quantification, as this is a key pathogenicity factor

  • Secondary metabolite analysis to identify downstream effects

• Plant infection assays: Standard methodologies include:

  • Detached leaf assays with measurement of lesion expansion rate

  • Whole plant infection with disease severity indices

  • Microscopic examination of host penetration structures

Research indicates that S. sclerotiorum pathogenicity involves a complex tri-phasic infection model, with initial colonization of dead tissue providing nutrients for establishment, followed by an active pathogenic phase involving oxalic acid production and cell wall degrading enzymes, and concluding with a second saprophytic phase . Understanding how fatty acid metabolism, particularly the pathways involving SS1G_14012, contributes to these phases could reveal new intervention points for disease control.

What techniques are most effective for studying the temporal expression patterns of SS1G_14012 during different infection stages?

Multiple complementary techniques effectively characterize SS1G_14012 expression dynamics during infection:

• Quantitative RT-PCR (qRT-PCR):

  • Most precise method for quantifying transcript levels

  • Requires careful normalization with multiple reference genes (typically actin, elongation factor 1α, and tubulin)

  • Sampling protocol typically includes:

    • Pre-infection (germinating ascospores/mycelia)

    • Early infection (0-12 hours post-inoculation)

    • Established infection (12-48 hours)

    • Late infection/sclerotia formation (48-96 hours)

• RNA-Seq analysis:

  • Provides genome-wide context for SS1G_14012 expression

  • Allows identification of co-regulated genes in same pathway

  • Typical protocol involves:

    • Total RNA extraction using TRIzol or RNeasy Plant kits

    • Poly-A selection or rRNA depletion

    • Illumina sequencing (30-50 million reads per sample)

    • Differential expression analysis using DESeq2 or EdgeR

• Promoter-reporter constructs:

  • GFP or luciferase fusions to SS1G_14012 promoter

  • Allows real-time visualization of expression in planta

  • Transformation using Agrobacterium-mediated methods

  • Confocal microscopy for spatial-temporal analysis

• Proteomics approaches:

  • Western blotting with specific antibodies

  • Mass spectrometry-based quantification

  • Activity-based protein profiling

• Chromatin immunoprecipitation (ChIP):

  • Identifies transcription factors regulating SS1G_14012

  • Requires antibodies against candidate transcription factors

  • ChIP-seq provides genome-wide binding profiles

Research on S. sclerotiorum pathogenicity suggests that the expression of metabolic genes, including those involved in fatty acid metabolism, is likely coordinated with the tri-phasic infection process. Early studies indicate that the transition between infection phases involves changes in cAMP levels, glucose availability, and ambient pH, which may serve as signals regulating SS1G_14012 expression .

How does the function of SS1G_14012 intersect with other metabolic pathways critical for S. sclerotiorum virulence?

The function of SS1G_14012 intersects with multiple metabolic pathways that collectively contribute to S. sclerotiorum virulence:

• Fatty acid elongation pathway: SS1G_14012 catalyzes the second step in the four-reaction cycle of fatty acid elongation, producing 3-hydroxyacyl-CoA intermediates. This pathway generates very-long-chain fatty acids (VLCFAs) critical for:

  • Membrane integrity during host penetration

  • Signaling molecule precursors

  • Formation of hydrophobic surface layers on sclerotia

• Oxalic acid production pathway: One of the principal virulence factors of S. sclerotiorum is oxalic acid . Research suggests potential links between lipid metabolism and oxalate production through:

  • Shared precursors from the TCA cycle

  • Regulatory crosstalk via common transcription factors

  • Coregulation under acidic pH conditions

• Cell wall degrading enzyme (CWDE) network: The expression of CWDEs, particularly polygalacturonases (SSPG1) and proteases (ASPS), occurs at the expanding edge of lesions . Integration with fatty acid metabolism may involve:

  • Membrane remodeling to support secretion apparatus

  • Lipid-based signaling triggering CWDE expression

  • Shared regulatory mechanisms responding to plant-derived signals

• cAMP signaling pathway: The transition between pathogenic and saprophytic phases is regulated by cAMP levels . SS1G_14012 activity may interface with this pathway through:

  • Fatty acid-derived second messengers affecting cAMP production

  • cAMP-dependent phosphorylation affecting enzyme activity

  • Shared transcriptional regulation

• Reactive oxygen species (ROS) metabolism: During infection, S. sclerotiorum must manage host-derived ROS. The fatty acid metabolism involving SS1G_14012 contributes to:

  • Membrane composition affecting resistance to oxidative damage

  • Production of antioxidant molecules

  • Redox balance through NADPH consumption

A systems biology approach combining transcriptomics, proteomics, and metabolomics has begun to reveal these complex pathway interactions. Preliminary metabolic flux analysis suggests that during the early pathogenic phase, carbon flux increases through both the fatty acid elongation pathway and oxalate production, supporting a coordinated upregulation of these virulence-associated pathways.

What are the most promising future research directions for understanding SS1G_14012 function in pathogenicity?

Several promising research directions could significantly advance our understanding of SS1G_14012's role in pathogenicity:

• Structural biology approaches: Obtaining high-resolution crystal structures of SS1G_14012 with various substrates and inhibitors would provide crucial insights into its catalytic mechanism and substrate specificity. Cryo-EM studies could additionally reveal potential protein-protein interactions within larger metabolic complexes.

• Systems biology integration: Comprehensive multi-omics approaches combining transcriptomics, proteomics, metabolomics, and fluxomics would establish the precise positioning of SS1G_14012 within the pathogen's metabolic network. This would clarify how fatty acid metabolism integrates with other virulence mechanisms during the tri-phasic infection process .

• Host-pathogen interface studies: Advanced imaging techniques such as correlative light and electron microscopy (CLEM) could visualize the localization and activity of SS1G_14012 during different infection stages, particularly at the host-pathogen interface.

• Comparative genomics and evolution: Analyzing the evolution of SS1G_14012 across fungal pathogens with different host ranges and infection strategies could reveal adaptive signatures related to pathogenicity.

• Inhibitor development and validation: Structure-based design of specific SS1G_14012 inhibitors, followed by in planta validation, would establish the enzyme's importance as a potential antifungal target. This approach could lead to new disease management strategies.

• Synthetic biology applications: Engineering SS1G_14012 variants with altered substrate specificities could provide tools for investigating the precise roles of different fatty acid species in pathogenicity.

• Environmental adaptation studies: Investigating how SS1G_14012 function adapts to different environmental conditions (temperature, pH, nutrient availability) could reveal regulatory mechanisms that coordinate pathogenicity in response to environmental cues.

These research directions, pursued in parallel, would provide a comprehensive understanding of how SS1G_14012 contributes to S. sclerotiorum's remarkable success as a necrotrophic pathogen with a broad host range.

How might advances in SS1G_14012 research translate to improved disease management strategies?

Advances in SS1G_14012 research could translate to practical disease management strategies through several pathways:

• Targeted fungicide development: Structure-based design of specific inhibitors targeting SS1G_14012 could lead to novel fungicides with reduced environmental impact compared to broad-spectrum compounds. The unique catalytic pocket of fungal 3-ketoacyl-CoA reductases provides opportunities for selective targeting without affecting plant or animal homologs.

• Biomarker development: Understanding the expression patterns and regulation of SS1G_14012 could yield biomarkers for early detection of infection before visible symptoms appear. Molecular diagnostics targeting SS1G_14012 transcripts could enable precision timing of control measures.

• Resistant crop development: Knowledge of how SS1G_14012-derived products interact with plant defense systems could inform breeding or engineering approaches for enhanced resistance. Plants could potentially be modified to produce compounds that specifically inhibit SS1G_14012 activity upon pathogen detection.

• Biological control strategies: Identifying natural inhibitors of SS1G_14012 from plant extracts or beneficial microorganisms could lead to biopesticide development. The complex infection cycle of S. sclerotiorum, particularly its requirement for senescent tissue establishment , offers multiple intervention points.

• Integrated pest management refinement: Understanding the environmental factors that regulate SS1G_14012 expression could improve prediction models for disease outbreaks and optimize timing of control measures. Climate variables affecting enzyme activity could be incorporated into decision support systems.

• Novel formulation technologies: Insights into the role of SS1G_14012 in sclerotia formation and survival could guide the development of treatments specifically targeting these resilient structures, reducing soil inoculum levels and breaking the disease cycle.