Recombinant Sclerotinia sclerotiorum Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
rcf1; aim31; SS1G_13108; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
rcf1
Target Protein Sequence
MPSNTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGKSTHTLTLSPSPPSLHHPSTQ KLTHPLTHPPGCILTTLALVGATRSIRAGDHNRTQRMFRARIYAQGFTLLAMVAGSMYWD SDRKKRKEFEGVLAEQKAKEKNEAWIKELEARDEEEKEMRRMRDERRRRAEGKSAASGLV VDAANAGAEEGEKTKNGIVDQMKGMVWGKK
Uniprot No.

Target Background

Function

Recombinant Sclerotinia sclerotiorum Altered Inheritance of Mitochondria Protein 31, Mitochondrial (AIM31) is a cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Sclerotinia sclerotiorum and why is it important in agricultural research?

Sclerotinia sclerotiorum is a necrotrophic fungal pathogen with a broad host range and worldwide distribution that causes Sclerotinia stem rot (SSR). It is particularly significant because it can lead to major yield losses in various crops, including chickpea (Cicer arietinum) . The fungus produces hard, asexual resting structures called sclerotia that facilitate its survival and spread. These sclerotia can germinate either carpogenically to form apothecia (from which ascospores are released) or myceliogenically to produce hyphae . Due to its economic importance and genetic tractability, S. sclerotiorum has become a model organism for studying plant-fungal interactions, fungicide resistance mechanisms, and mitochondrial inheritance patterns.

What molecular techniques are commonly used for studying recombinant S. sclerotiorum strains?

Several molecular techniques are essential for studying recombinant S. sclerotiorum strains:

  • RNA sequencing and de novo transcriptome assembly for comprehensive gene expression analysis and genome identification

  • PCR-based methods, including qRT-PCR for gene expression quantification

  • RACE (Rapid Amplification of cDNA Ends) for determining terminal sequences of genes

  • Gene replacement strategies to create mutant strains, as demonstrated in studies of the SdhB gene

  • Cloning techniques using vectors like pCR-Blunt II-TOPO for manipulating gene sequences

When working with mitochondrial proteins like aim31, mitochondrial isolation protocols followed by protein extraction and Western blotting are typically employed to verify successful recombinant expression. Additionally, fluorescent tagging combined with confocal microscopy can be used to visualize protein localization within the mitochondria.

How are sclerotial development and gene expression related in S. sclerotiorum?

Sclerotial development in S. sclerotiorum is a complex process regulated by multiple genes. Research has identified several key genes involved in this process:

  • The pac1 gene (AY005467) is required for sclerotial development

  • The smk1 gene (AY351633) encodes a mitogen-activated protein kinase (MAPK) that shows dramatically increased transcription during sclerotogenesis

  • The adenylate cyclase sac1 gene (DQ526020) affects multiple developmental pathways and pathogenicity

Studies using quantitative reverse transcriptase-PCR (qRT-PCR) have demonstrated that mutations affecting mitochondrial proteins (such as components of the succinate dehydrogenase complex) can significantly impact pac1 expression levels and subsequently affect sclerotial development . For instance, boscalid-resistant (BR) strains and certain gene replacement mutants (GSM) have shown lower expression of pac1 compared to wild-type strains, correlating with reduced or absent sclerotial formation .

How do mutations in mitochondrial proteins affect virulence and stress responses in S. sclerotiorum?

Mutations in mitochondrial proteins, particularly those involved in respiratory complexes like succinate dehydrogenase (SDH), can have substantial effects on both virulence and stress responses in S. sclerotiorum. Research has shown that:

  • Mutations in the SdhB subunit (e.g., the A11V mutation) can alter osmotic stress responses. Boscalid-resistant (BR) strains and gene replacement mutants (GSM) carrying this mutation demonstrate increased sensitivity to osmotic stress compared to wild-type strains .

  • Interestingly, not all stress responses are equally affected. The same SdhB mutants showed no significant difference in their response to oxidative stress (induced by paraquat) or temperature stress compared to wild-type strains .

  • Changes in mitochondrial protein function can alter energy production and metabolic processes, potentially affecting the expression of genes involved in pathogenicity, as evidenced by RNA sequencing studies revealing differential expression of genes related to oxidation-reduction processes, metabolic processes, and carbohydrate metabolism during plant infection .

  • Mutations may also impact secondary metabolite production, which plays a crucial role in virulence. Transcriptomic analyses have identified upregulation of secondary metabolite biosynthesis clusters during host infection .

The specific mechanisms by which mitochondrial protein mutations affect these processes often involve altered respiratory efficiency, reactive oxygen species generation, or disruption of signaling pathways that coordinate responses to environmental stresses.

What experimental approaches can differentiate primary effects of aim31 mutations from secondary metabolic adaptations?

Differentiating primary effects of aim31 mutations from secondary metabolic adaptations requires a multi-faceted experimental approach:

  • Time-course experiments: Analyzing changes immediately following aim31 mutation/alteration versus long-term adaptations can help distinguish primary from secondary effects. RNA sequencing at multiple time points (e.g., 6, 12, 24, and 48 hours post-induction) can reveal the cascade of gene expression changes.

  • Complementation studies: Reintroducing wild-type aim31 to mutant strains and assessing whether all phenotypes are rescued can identify which effects are directly linked to aim31 function.

  • Metabolomic profiling: Comparing the metabolome of wild-type and aim31 mutant strains can identify specific metabolic pathways affected. This approach can be particularly powerful when combined with stable isotope labeling to track metabolic flux.

  • Proteomic analysis of protein-protein interactions: Using techniques such as co-immunoprecipitation or yeast two-hybrid screening to identify direct interaction partners of aim31 can help establish primary function pathways.

  • Comparative transcriptomics across different genetic backgrounds: Similar to approaches used in studying SDH mutations, comparing gene expression profiles across multiple strains (wild-type, aim31 mutants, and other mitochondrial protein mutants) can help identify consistent expression changes specifically linked to aim31 function versus compensatory adaptations .

How does gene expression of S. sclerotiorum differ between in vitro growth and during host infection?

Transcriptomic analysis has revealed substantial differences in S. sclerotiorum gene expression between in vitro growth and during host infection. During infection of chickpea, 9,491 and 10,487 S. sclerotiorum genes were significantly differentially expressed relative to in vitro conditions in moderately resistant and highly susceptible chickpea lines, respectively .

Key differences include:

  • Upregulation of carbohydrate-active enzymes: These enzymes are crucial for degrading plant cell walls and accessing nutrients during infection .

  • Increased expression of secondary metabolite biosynthesis clusters: These compounds often play roles in virulence and host manipulation .

  • Enhanced expression of transcription factors: These regulate the coordinated expression of genes required for pathogenicity .

  • Upregulation of candidate secreted effectors: These proteins may manipulate host defense responses .

  • Enrichment of genes involved in oxidation-reduction processes: This reflects adaptation to the oxidative environment during host infection and likely involves numerous mitochondrial proteins .

Additionally, Gene Ontology analysis has identified enrichment of biological processes such as metabolic processes, carbohydrate metabolism, response to stimulus, and signal transduction among upregulated genes during infection . These changes illustrate the complex metabolic and regulatory reprogramming that occurs as S. sclerotiorum transitions from saprophytic to pathogenic growth.

What are the optimal protocols for transfection and gene replacement in S. sclerotiorum?

Successful transfection and gene replacement in S. sclerotiorum requires careful optimization of several key parameters:

Transfection Protocol:

  • Protoplast preparation: Digest young, actively growing mycelia with a combination of cell wall-degrading enzymes (typically lysing enzymes, driselase, and chitinase) in an osmotically stabilized buffer.

  • DNA preparation: Use high-quality, endotoxin-free plasmid DNA with appropriate selectable markers (hygromycin B resistance is commonly used for S. sclerotiorum).

  • Transformation conditions: Optimize PEG-mediated transformation by testing different PEG concentrations (40-60%), incubation times (10-30 minutes), and DNA concentrations (5-20 μg).

  • Recovery and selection: Allow transformed protoplasts to recover on regeneration medium containing an osmotic stabilizer before transferring to selective medium.

Gene Replacement Strategy:

For targeted gene replacement, as demonstrated in studies of the SdhB gene, a multistep approach is effective :

  • Construct design: Create a replacement cassette containing the mutant gene flanked by its native promoter and terminator regions, plus a selectable marker.

  • Homologous recombination: For S. sclerotiorum, homologous arms of at least 1 kb on each side of the target gene improve recombination efficiency.

  • Verification: Confirm successful integration by PCR amplification across the integration junctions and sequencing.

  • Phenotypic analysis: Compare the phenotypes of gene replacement mutants (e.g., GRM1, GRM2) with wild-type strains to confirm functional effects of the mutation .

For studies involving RNA viruses or transient expression, in vitro transcription followed by transfection of viral transcripts can be used, as demonstrated in studies with hypovirus infections of S. sclerotiorum .

What controls are essential when investigating the effects of aim31 mutations on fungal physiology?

  • Wild-type strain: Include the parental strain from which mutants are derived as the primary control for all phenotypic and molecular analyses.

  • Complemented mutant: Reintroduce the wild-type aim31 gene into the mutant background to verify that observed phenotypes are specifically due to the aim31 mutation.

  • Empty vector control: For studies involving expression constructs, include a strain transformed with the empty vector to control for effects of the transformation process or selectable marker.

  • Site-directed mutants: Generate multiple types of mutations (point mutations, deletions, etc.) in aim31 to establish structure-function relationships.

  • Mitochondrial function controls: Include strains with mutations in other mitochondrial proteins (e.g., SdhB, SdhC, SdhD) to differentiate aim31-specific effects from general mitochondrial dysfunction .

  • Environmental controls: Test phenotypes under multiple conditions (different media, stress factors, etc.) as some phenotypes may only manifest under specific conditions, as seen with osmotic stress sensitivity in SdhB mutants .

  • Gene expression landmarks: Monitor expression of known marker genes (e.g., pac1, smk1, sac1) that regulate key developmental processes to place aim31 within established regulatory networks .

Implementing these controls allows researchers to distinguish direct effects of aim31 mutations from secondary effects, transformation artifacts, or strain-specific variations.

How should researchers design time-course experiments to study aim31 function during infection processes?

Designing effective time-course experiments to study aim31 function during infection requires careful consideration of sampling points, controls, and analytical methods:

Experimental Design Framework:

  • Infection model selection: Choose an appropriate host plant (e.g., chickpea, which has been well-studied with S. sclerotiorum) . Consider using both susceptible and resistant varieties to capture differential responses.

  • Synchronization of infection: Standardize inoculum preparation, concentration, and inoculation methods to ensure synchronized infection progression.

  • Sampling timeline: Based on the infection cycle of S. sclerotiorum, include these critical time points:

    • 0-6 hours: Initial contact and penetration

    • 12-24 hours: Early colonization

    • 24-48 hours: Establishment and lesion formation

    • 72-96 hours: Advanced disease and sclerotia formation

  • Parallel in vitro controls: Maintain fungal cultures under non-infecting conditions to distinguish infection-specific responses from general growth effects.

Analytical Approaches:

  • Transcriptomics: RNA sequencing at each time point to track aim31 expression and co-regulated genes .

  • Proteomics: Targeted proteomics to track aim31 protein levels and post-translational modifications.

  • Microscopy: Confocal microscopy with fluorescently tagged aim31 to track localization changes during infection.

  • Metabolomics: Targeted metabolite analysis to identify changes in mitochondrial function and energy metabolism.

  • Physiological assays: Measure parameters such as reactive oxygen species production, ATP levels, and mitochondrial membrane potential at each time point.

Data Integration:

Create a temporal map of aim31 function by integrating multiple data types, similar to approaches used in comprehensive gene expression studies of S. sclerotiorum during infection . This multi-omics approach allows researchers to place aim31 function within the broader context of the infection process.

What are the recommended approaches for analyzing differential gene expression in S. sclerotiorum under varying conditions?

Analysis of differential gene expression in S. sclerotiorum requires robust bioinformatic pipelines and statistical approaches:

Data Processing Pipeline:

  • Quality control and preprocessing: Trim low-quality reads and adapter sequences using tools like Trimmomatic or BBDuk.

  • Read mapping: Align reads to the S. sclerotiorum reference genome using splice-aware aligners like STAR or HISAT2. For studies involving recombinant strains, consider de novo assembly approaches as used in transcriptome studies of virus-infected S. sclerotiorum .

  • Quantification: Count reads mapping to genes using tools like featureCounts or HTSeq.

  • Normalization: Apply appropriate normalization methods (e.g., TPM, FPKM, or preferably, variance stabilizing transformation) to account for differences in sequencing depth and gene length.

Statistical Analysis:

  • Differential expression testing: Use established statistical frameworks like DESeq2 or edgeR to identify significantly differentially expressed genes (typically using an adjusted p-value threshold of 0.05 and a fold-change threshold).

  • Multiple condition comparison: For time-course data or multiple treatment comparisons, use specialized approaches like maSigPro or time-course analysis modules in DESeq2.

  • Batch effect correction: Apply methods like ComBat or include batch as a covariate in your model to minimize non-biological variation.

Functional Interpretation:

  • Gene Ontology enrichment: Identify enriched biological processes, molecular functions, and cellular components using tools like GOseq or topGO, as applied in studies of S. sclerotiorum infection .

  • Pathway analysis: Map differentially expressed genes to known pathways using KEGG or other pathway databases.

  • Gene set enrichment analysis: Use GSEA to identify coordinated changes in predefined gene sets.

  • Co-expression network analysis: Identify modules of co-regulated genes using WGCNA or similar approaches.

  • Integration with phenotypic data: Correlate expression changes with observed phenotypes, as demonstrated in studies linking SdhB gene expression to sclerotial development .

How can researchers differentiate between genetic and epigenetic factors affecting aim31 expression?

Differentiating between genetic and epigenetic factors affecting aim31 expression requires a multi-faceted experimental approach:

Genetic Factor Analysis:

  • Sequence analysis: Compare the promoter, coding, and regulatory regions of aim31 across different strains to identify polymorphisms.

  • Allelic variation studies: Use allele-specific expression assays to determine if expression differences are linked to specific alleles.

  • QTL mapping: In populations with variable aim31 expression, perform QTL analysis to identify genetic loci controlling expression.

  • CRISPR-based promoter editing: Systematically modify promoter elements to identify specific regulatory sequences.

Epigenetic Factor Analysis:

  • DNA methylation profiling: Use bisulfite sequencing to map methylation patterns in the aim31 promoter region under different conditions.

  • Chromatin immunoprecipitation (ChIP): Assess histone modifications (H3K4me3, H3K27ac, H3K9me3, etc.) at the aim31 locus using ChIP-seq.

  • Chromatin accessibility: Apply ATAC-seq to identify open chromatin regions associated with active aim31 transcription.

  • Small RNA analysis: Profile small RNAs that might target aim31 transcripts for degradation or translational repression.

Experimental Manipulations to Distinguish Mechanisms:

  • Epigenetic inhibitor treatments: Apply DNA methyltransferase inhibitors (e.g., 5-azacytidine) or histone deacetylase inhibitors (e.g., trichostatin A) and monitor effects on aim31 expression.

  • Transgenerational studies: Assess stability of aim31 expression patterns across multiple generations of S. sclerotiorum under consistent conditions.

  • Environmental perturbation: Expose strains to different stresses and track both immediate and long-term changes in aim31 expression and associated epigenetic marks.

  • Genetic background swaps: Introduce identical aim31 reporters into different genetic backgrounds to separate strain-specific epigenetic effects from genetic variation.

This comprehensive approach, similar to methods used to study expression of genes like pac1 and SdhB in S. sclerotiorum , enables researchers to determine the relative contributions of genetic and epigenetic mechanisms to aim31 regulation.

What are common challenges in generating stable recombinant S. sclerotiorum strains and how can they be overcome?

Generating stable recombinant S. sclerotiorum strains presents several challenges that researchers should anticipate and address:

Challenge 1: Low transformation efficiency

  • Solution: Optimize protoplast preparation by harvesting young, actively growing mycelia (18-24 hours) and using freshly prepared enzyme solutions. Increase PEG concentration (50-60%) and extend incubation time during transformation. Consider using electroporation as an alternative method.

Challenge 2: Off-target integration

  • Solution: Increase the length of homologous flanking regions (>1 kb on each side) to improve targeted integration efficiency. Use CRISPR-Cas9 systems to create double-strand breaks at the target site, enhancing homology-directed repair. Thoroughly screen transformants using both PCR across integration junctions and Southern blotting to confirm single-copy integration at the correct locus.

Challenge 3: Phenotypic instability

  • Solution: Maintain transformants on selective media to prevent reversion. Use single-spore isolation to ensure genetic homogeneity. Perform regular PCR verification of the integrated construct. Test stability across multiple generations and under different growth conditions.

Challenge 4: Silencing of transgenes

  • Solution: Use native S. sclerotiorum promoters rather than heterologous promoters. Position the transgene in genomically stable regions. Consider using codon-optimized sequences. Monitor expression levels over multiple generations to detect silencing.

Challenge 5: Difficulty in obtaining homokaryotic transformants

  • Solution: Perform multiple rounds of single-spore isolation on selective media. Use genetic markers or fluorescent proteins to identify homokaryotic sectors. Consider using microconidiation to facilitate the isolation of homokaryotic strains.

Challenge 6: Poor growth or unexpected phenotypes in transformants

  • Solution: Generate multiple independent transformants to differentiate transformation-specific effects from insertional mutagenesis. Include appropriate controls, such as transformants with empty vectors. Perform complementation experiments to confirm phenotype-genotype relationships, as demonstrated in studies of SdhB mutations .

How can researchers optimize protein extraction specifically for mitochondrial proteins like aim31?

Extracting and analyzing mitochondrial proteins like aim31 from S. sclerotiorum requires specialized protocols to maintain protein integrity and ensure high yield:

Mitochondrial Isolation Protocol:

  • Growth optimization: Cultivate S. sclerotiorum in liquid medium (potato dextrose broth) for 48-72 hours until sufficient mycelial mass is obtained.

  • Cell disruption: Harvest and rinse mycelia with cold isolation buffer (0.6M mannitol, 10mM Tris-HCl pH 7.4, 1mM EDTA, 1mM PMSF, 0.1% BSA). Use mechanical disruption methods such as grinding in liquid nitrogen or bead-beating, as enzymatic methods may damage mitochondrial membranes.

  • Differential centrifugation:

    • Low-speed centrifugation (1,000 × g, 10 min) to remove cell debris

    • Medium-speed centrifugation (3,000 × g, 10 min) to remove nuclei and remaining debris

    • High-speed centrifugation (12,000 × g, 20 min) to pellet mitochondria

  • Purification: For higher purity, use density gradient centrifugation with Percoll or sucrose gradients to separate mitochondria from other organelles.

Protein Extraction from Isolated Mitochondria:

  • Membrane protein solubilization: Use mild detergents such as digitonin (0.5-1%) or n-dodecyl-β-D-maltoside (0.5-1%) to solubilize mitochondrial membrane proteins while maintaining native protein interactions.

  • Fractionation options:

    • For whole mitochondrial proteins: Lyse mitochondria directly in sample buffer containing 8M urea or 2% SDS

    • For submitochondrial fractionation: Use differential detergent treatment to separate outer membrane, inner membrane, and matrix proteins

  • Protease inhibition: Include a comprehensive protease inhibitor cocktail to prevent degradation of mitochondrial proteins, which are particularly susceptible to proteolysis.

Verification and Analysis:

  • Western blotting: Use antibodies against known mitochondrial marker proteins (e.g., cytochrome c oxidase) to confirm mitochondrial enrichment.

  • Mass spectrometry: For comprehensive mitochondrial proteome analysis, employ LC-MS/MS with data-dependent acquisition.

  • Activity assays: For functional assessment of mitochondrial fractions, measure activities of respiratory chain complexes using spectrophotometric assays.

  • Blue native PAGE: For analysis of intact protein complexes, use blue native PAGE followed by in-gel activity assays or second-dimension SDS-PAGE.

This optimized approach ensures high-quality mitochondrial protein extracts suitable for studying aim31 and other mitochondrial proteins in S. sclerotiorum.

What strategies help resolve inconsistent phenotypes in recombinant S. sclerotiorum strains?

Inconsistent phenotypes in recombinant S. sclerotiorum strains can significantly complicate research interpretation. Several strategies can help identify and resolve these issues:

Standardization of Growth Conditions:

  • Media preparation: Use consistent sources of media components and standardized preparation protocols. For example, potato dextrose agar (PDA) from different manufacturers can vary in composition.

  • Environmental control: Maintain strict temperature (typically 20-22°C), humidity, and light conditions. Even minor variations can affect sclerotial development and other phenotypes .

  • Inoculum standardization: Use consistent methods for preparing inoculum (e.g., standardized plug size, mycelial age, or spore concentration).

Genetic Verification:

  • Regular genotyping: Periodically confirm the genetic status of recombinant strains through PCR, sequencing, or Southern blotting to detect potential genetic instability or contamination.

  • Single-spore isolation: Regularly perform single-spore isolation to maintain genetic homogeneity, particularly when inconsistent phenotypes are observed.

  • Expression verification: Monitor expression levels of the transgene or modified gene using qRT-PCR to detect potential silencing or variable expression .

Experimental Design Approaches:

  • Multiple independent transformants: Generate and analyze multiple independent transformants with the same construct to distinguish strain-specific effects from those directly related to the genetic modification.

  • Complementation analysis: Reintroduce the wild-type gene into mutant strains to confirm that phenotypes are specifically due to the targeted genetic modification, as demonstrated in studies with SdhB mutations .

  • Marker gene inclusion: Include reporter genes (e.g., GFP) in constructs to facilitate visual confirmation of transgene expression.

  • Comparative phenotyping: Test multiple phenotypes (growth rate, sclerotial production, stress responses, pathogenicity) to develop a comprehensive phenotypic profile for each strain .

Data Analysis Strategies:

  • Hierarchical clustering: Use multivariate analysis to group strains based on phenotypic similarity, potentially identifying outliers or strain mixtures.

  • Meta-analysis across experiments: Compile data from multiple experiments to identify consistent versus variable phenotypes.

  • Statistical approaches: Apply appropriate statistical methods to quantify phenotypic variation and distinguish significant differences from experimental noise.

By implementing these strategies, researchers can significantly improve phenotypic consistency and research reproducibility when working with recombinant S. sclerotiorum strains.

How might CRISPR-Cas9 technology advance the study of mitochondrial proteins in S. sclerotiorum?

CRISPR-Cas9 technology holds transformative potential for advancing the study of mitochondrial proteins like aim31 in S. sclerotiorum:

Precision Genetic Engineering:

  • Targeted knock-in/knock-out: CRISPR-Cas9 enables precise modification of nuclear genes encoding mitochondrial proteins without introducing selectable markers or causing off-target effects.

  • Allelic replacements: Create specific point mutations in mitochondrial protein genes to study structure-function relationships, similar to the approach used for SdhB mutations but with higher efficiency and precision .

  • Domain swapping: Engineer chimeric mitochondrial proteins by precisely replacing functional domains to investigate their specific roles.

Regulatory Element Manipulation:

  • Promoter editing: Modify endogenous promoters of nuclear-encoded mitochondrial proteins to alter expression patterns without disrupting genomic context.

  • UTR engineering: Edit 5' and 3' UTRs to study post-transcriptional regulation of mitochondrial protein expression.

  • Enhancer mapping: Systematically delete putative enhancer regions to identify distal regulatory elements controlling mitochondrial protein expression.

Novel Applications:

  • Mitochondrial genome editing: Develop mitochondria-targeted CRISPR systems to directly edit the mitochondrial genome, addressing the unique challenges of organellar DNA modification.

  • CRISPRi/CRISPRa: Implement CRISPR interference or activation systems to reversibly modulate expression of mitochondrial proteins without permanent genetic modifications.

  • Base editing: Use cytidine or adenine base editors to create precise point mutations without double-strand breaks, especially valuable for studying conserved residues in mitochondrial proteins.

  • Prime editing: Apply prime editing technology to make targeted insertions, deletions, and all possible base-to-base conversions in mitochondrial protein genes with minimal off-target effects.

High-throughput Applications:

  • Multiplexed screening: Create CRISPR libraries targeting all nuclear-encoded mitochondrial proteins to identify novel factors involved in specific mitochondrial functions or fungicide resistance.

  • Synthetic genetic interaction mapping: Systematically create double mutants to identify genetic interactions between mitochondrial proteins and other cellular components.

These CRISPR-based approaches would significantly accelerate research on mitochondrial proteins in S. sclerotiorum, providing unprecedented precision in genetic manipulation and enabling entirely new experimental paradigms.

What emerging technologies could revolutionize the study of mitochondrial inheritance and protein function in fungi?

Several emerging technologies show promise for transforming our understanding of mitochondrial inheritance and protein function in fungi like S. sclerotiorum:

Single-Cell Omics Technologies:

  • Single-cell RNA sequencing: Analyze mitochondrial gene expression heterogeneity within fungal populations, potentially revealing subpopulations with distinct mitochondrial states.

  • Single-cell proteomics: Emerging mass spectrometry techniques for single-cell analysis could reveal cell-to-cell variation in mitochondrial protein abundance and modifications.

  • Spatial transcriptomics: Map gene expression spatially across fungal colonies or during host infection to understand context-dependent regulation of mitochondrial proteins .

Advanced Imaging Technologies:

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED can resolve individual mitochondrial proteins and their dynamic interactions at nanometer resolution.

  • Correlative light and electron microscopy (CLEM): Combine fluorescence imaging of specific mitochondrial proteins with ultrastructural details from electron microscopy.

  • Live-cell imaging probes: Genetically encoded sensors for mitochondrial membrane potential, reactive oxygen species, or calcium flux can provide real-time insights into mitochondrial function.

Protein Structure and Interaction Analysis:

  • Cryo-electron microscopy: Determine high-resolution structures of fungal mitochondrial protein complexes, providing insights into their function and evolutionary adaptations.

  • Proximity labeling: BioID or APEX2-based approaches can map the protein interaction landscape of mitochondrial proteins in their native context.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Analyze protein dynamics and conformational changes in mitochondrial proteins under different conditions.

Synthetic Biology Approaches:

  • Mitochondrial transplantation: Develop methods to transfer mitochondria between fungal strains to study inheritance patterns and compatibility.

  • Minimal mitochondrial genomes: Engineer simplified mitochondrial genomes to understand essential functions and evolutionary constraints.

  • Optogenetic control: Develop light-activated tools to modulate mitochondrial function with spatiotemporal precision.

Integrative Computational Methods:

  • Multi-omics data integration: Combine transcriptomics, proteomics, metabolomics, and phenomics data to build comprehensive models of mitochondrial function .

  • Network analysis tools: Identify key regulators and interaction networks controlling mitochondrial inheritance and protein function.

  • Machine learning approaches: Develop predictive models for mitochondrial protein localization, function, and impact of mutations.

These emerging technologies, when applied to S. sclerotiorum and other fungal systems, will provide unprecedented insights into mitochondrial biology and potentially reveal new targets for antifungal development or biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.