Recombinant Sclerotinia sclerotiorum Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
mic60; SS1G_13150; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
41-659
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
mic60
Target Protein Sequence
ADKSSISDSRPPVLPGSASEATSEPLPPGAVATPNSAAPTPATPTSSTIPAENVPLTPPP PGVQSPGPPPPSSSPPPPAPKPKRRFFRKFFTTLFLLTTLGFGGGVYYSRINDNFHDFFT EYVPFGEDAVLYFEEQEFRKRFPLISSRASRPPRDTGEQVKIPSQSGVSWRVANENKDST GRHTSSAKDKVKPSEAVQTPHDSKPADRVKAVEQVKSGNSPVKNSPAPPATPESKPSNVQ KDPEVNEPSRAYKKIERIDPINIPNGNEPVVQELVKIMNDIIAVVNADNANARFTSTMDK AKAELNRVGAKILDMKDAALKQADEKIKSSDAEFDRAAMQLMQNFKNQQAEQEAQFRAEY EAERKRIHENYEQKLKSELDRANEVNEKTLQNNLTEQALELKRAFLADVKNRVEQEREGR LGKLSELTSTVNDLEKLTGDFNTVVDQNLKTQHLHVAVEAVRANLEKSQIPRPFTRELAA LKEIASDDPVVNAAIASINPVAYQKGVPSSAALIDRFRRVASEVRKASLLPEEAGVASHA SSYVLSKLLFKKKGLATGDDVESILTRTETFLEEGDLDGAAREMNGLKGWAKTLSKDWLG EVRKVLEVQQALDKPDYKV
Uniprot No.

Target Background

Function

Recombinant Sclerotinia sclerotiorum Formation of crista junctions protein 1 (fcj1) is a component of the Mitochondrial Cristae Organization System (MICOS) complex. This large protein complex, located within the inner mitochondrial membrane, plays critical roles in maintaining crista junctions, preserving inner membrane architecture, and forming contact sites with the outer membrane. It functions to maintain the connection between cristae membranes and the inner boundary membrane and facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.

Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its role in mitochondrial structure?

Fcj1 (Formation of Crista Junction protein 1) is a mitochondrial inner membrane protein that plays a crucial role in the formation and maintenance of crista junctions (CJs). CJs are tubular invaginations of the inner membrane that connect the inner boundary membrane with the cristae membrane . These architectural elements are critical for proper mitochondrial function and organization .

In yeast, Fcj1 (the ortholog of mitofilin in mammals) is specifically enriched at CJs and modulates their formation in an antagonistic manner to subunits e and g of the F1F0 ATP synthase . Cells lacking Fcj1 exhibit dramatic alterations in mitochondrial ultrastructure, including the absence of CJs and the formation of concentric stacks of inner membrane within the mitochondrial matrix .

What are the key structural domains of Fcj1 and their functions?

Fcj1 contains several key structural domains that contribute to its function:

  • N-terminal Transmembrane Domain: Anchors Fcj1 to the inner mitochondrial membrane. While the presence of this domain is crucial for protein function, its specific amino acid sequence appears less critical, as demonstrated by domain-swap experiments .

  • Coiled-coil Domain (residues 166-342 in yeast): Essential for CJ formation. Deletion of this domain drastically reduces the number of CJs to approximately 4% of wild-type levels .

  • C-terminal Domain (final 68 amino acids in yeast): The most conserved part of Fcj1, crucial for protein function. Its absence severely impairs CJ formation, resulting in irregular cristae structures and stacked cristae membranes . This domain:

    • Mediates homotypic interactions, enabling Fcj1 oligomerization

    • Interacts with the TOB/SAM complex in the outer membrane

    • Is required for genetic interaction with F1F0 ATP synthase subunit e

How is Fcj1 specifically localized at crista junctions?

Immunogold electron microscopy studies have demonstrated that Fcj1 is specifically enriched at CJs, making it the first protein identified with this precise localization pattern . This enrichment is unique and not observed for other mitochondrial proteins analyzed in comparable studies .

The mechanism of this specific localization appears to involve:

  • Proper anchoring to the inner membrane via its transmembrane segment

  • Interactions with other proteins, particularly the TOB/SAM complex of the outer membrane

  • Self-oligomerization mediated by the C-terminal domain

Interestingly, regions of the inner membrane where Fcj1 is enriched show correspondingly lower levels of F1F0 ATP synthase subunits e and g, suggesting an antagonistic spatial relationship between these proteins .

How does the C-terminal domain of Fcj1 enable crista junction formation?

The C-terminal domain of Fcj1 (residues 473-540 in yeast) plays multiple essential roles in CJ formation:

  • Mediating Homotypic Interactions: Biochemical analysis shows that the purified C-terminal domain forms oligomeric complexes corresponding to tetramers to hexamers . This oligomerization capacity is consistent with earlier observations of dimeric, trimeric, or tetrameric Fcj1 complexes in detergent-solubilized mitochondria .

  • Interaction with the TOB/SAM Complex: The C-terminal domain interacts with Tob55 of the Translocase of Outer membrane β-barrel proteins (TOB)/Sorting and Assembly Machinery (SAM) complex . This interaction appears critical for establishing contact sites between inner and outer mitochondrial membranes, thereby positioning CJs in proximity to the outer membrane .

  • Antagonism with F1F0 ATP Synthase Oligomerization: The genetic interaction between Fcj1 and F1F0 ATP synthase subunit e requires the C-terminal domain, suggesting this region mediates the antagonistic relationship between Fcj1 and F1F0 ATP synthase oligomerization .

When the C-terminal domain is deleted, CJ formation is drastically impaired (reduced to approximately 9% of wild-type levels), and concentric cristae stacks form without proper junctions to the inner boundary membrane .

What is the relationship between Fcj1 and F1F0-ATP synthase in regulating cristae morphology?

Fcj1 and the F1F0-ATP synthase complex have an antagonistic relationship that dynamically regulates cristae architecture:

  • Opposing Effects on Membrane Curvature: F1F0-ATP synthase oligomerization (promoted by subunits e and g) induces positive curvature at cristae tips, while Fcj1 appears to promote negative curvature at CJs .

  • Spatial Segregation: Immunogold labeling shows Fcj1 enrichment at CJs where F1F0 subunits e and g are depleted, whereas these subunits are concentrated at cristae tips where Fcj1 is absent .

  • Effects on F1F0 Oligomerization: Cells lacking Fcj1 show increased levels of F1F0-ATP synthase supercomplexes, while Fcj1 overexpression reduces these oligomeric forms .

  • Genetic Interaction: Overexpression of wild-type Fcj1 in strains lacking F1F0 subunit e exhibits a dominant-negative effect on growth, confirming the genetic interaction between these components .

How can the study of Fcj1 in S. cerevisiae inform research on its ortholog in Sclerotinia sclerotiorum?

Studies of Fcj1 in S. cerevisiae provide valuable insights for investigating its ortholog in plant pathogenic fungi like S. sclerotiorum:

  • Domain Conservation Analysis: The high conservation of the C-terminal domain suggests its functional importance across fungal species . Comparative sequence analysis between yeast and S. sclerotiorum Fcj1 could reveal conserved motifs critical for protein function.

  • Structure-Function Relationships: The detailed understanding of how specific domains contribute to Fcj1 function in yeast provides testable hypotheses for structure-function studies in S. sclerotiorum.

  • Experimental Approach Translation: Methods for Fcj1 protein isolation, functional assays, and microscopic visualization developed in yeast can be adapted for S. sclerotiorum research.

  • Potential Pathogenicity Connections: Given the central role of mitochondrial function in cellular energy production, investigating whether Fcj1-mediated mitochondrial architecture influences virulence or stress responses in S. sclerotiorum could reveal novel pathogenicity mechanisms.

What techniques are most effective for visualizing crista junctions and studying Fcj1 localization?

Several complementary approaches have proven valuable for studying CJ architecture and Fcj1 localization:

Table 1: Quantitative Analysis of CJ Formation in Fcj1 Mutants

StrainRelative number of CJs per mitochondrial section (%)
Δfcj1/Fcj1 DLD1-TM68
Δfcj1/Fcj1 G52L124
Δfcj1/Fcj1 Cyt b246
Δfcj1/Fcj1 Δ166-342His4
Δfcj1/Fcj1 1-4729

Data adapted from electron microscopy analysis of various Fcj1 mutants compared to control (Δfcj1/Fcj1 wt set to 100%)

What expression systems are optimal for producing recombinant Fcj1 for structural and functional studies?

For recombinant Fcj1 expression and purification, several systems have been successfully employed, each with specific advantages:

  • Bacterial Expression Systems:

    • E. coli has been used to express the C-terminal domain (residues 473-540) as a GST fusion protein, enabling purification via glutathione Sepharose affinity chromatography

    • Size exclusion chromatography can further purify the cleaved protein to analyze oligomerization state

    • This approach is particularly useful for domain-specific studies but may be challenging for full-length membrane proteins

  • Yeast Expression Systems:

    • Homologous expression in S. cerevisiae using plasmid-based systems allows for proper folding and post-translational modifications

    • Can incorporate affinity tags (e.g., His12 tag) for purification and detection

    • Enables functional complementation studies in Δfcj1 backgrounds

  • Cell-Free Expression Systems:

    • May be advantageous for producing full-length membrane proteins in the presence of appropriate lipids or detergents

    • Allows incorporation of non-natural amino acids for specialized biophysical studies

For structural studies of full-length Fcj1 from S. sclerotiorum, a combined approach might be optimal: bacterial expression of soluble domains for crystallization and detailed biochemical analysis, complemented by yeast or insect cell expression systems for the full-length protein.

What genetic approaches can effectively assess Fcj1 function in fungal systems?

Several genetic strategies have proven effective for investigating Fcj1 function:

  • Gene Deletion/Complementation:

    • Complete deletion of fcj1 to assess the null phenotype

    • Complementation with wild-type or mutant versions to identify essential domains

    • Analysis of growth on fermentable versus non-fermentable carbon sources to assess mitochondrial function

  • Domain Mutagenesis:

    • Targeted mutations of specific domains (e.g., Fcj1 G52L mutation in the transmembrane domain)

    • Domain swapping (e.g., replacing the transmembrane segment with that from another protein)

    • Deletion of specific domains (e.g., coiled-coil domain or C-terminal domain)

  • Protein Tagging:

    • Addition of epitope or affinity tags for protein detection and purification

    • Careful validation that tags do not interfere with protein function

  • Overexpression Studies:

    • Assessment of dominant-negative effects when mutant forms are expressed in wild-type backgrounds

    • Study of genetic interactions through overexpression in specific genetic backgrounds (e.g., in strains lacking F1F0-ATP synthase subunits)

These approaches can be adapted to S. sclerotiorum using appropriate transformation protocols and selection markers for filamentous fungi.

What is the relationship between the MICOS/MINOS/MitOS complex and Fcj1?

Fcj1 has been identified as a component of a larger multisubunit complex variously termed MICOS (Mitochondrial Contact Site), MINOS (Mitochondrial Inner Membrane Organizing System), or MitOS . This complex plays a central role in:

Interestingly, deletion of another component of this complex, Aim13/Mcs19, results in a reduced number of CJs but does not significantly impact cellular growth rate in yeast . This suggests functional specialization among complex components or potential compensatory mechanisms.

The identification of Fcj1 homologs as part of this conserved complex across diverse fungal species suggests evolutionary pressure to maintain this structural system, highlighting its fundamental importance to mitochondrial function.

How conserved is Fcj1 structure and function across fungal species?

Fcj1 exhibits significant conservation across fungal species, particularly in key functional domains:

  • C-terminal Domain: The most conserved region of the protein, essential for function and protein-protein interactions . This high conservation suggests evolutionary pressure to maintain specific structural features required for CJ formation.

  • Coiled-coil Domain: While showing more sequence variation than the C-terminus, the structural motif itself is conserved, reflecting its importance in protein oligomerization and potentially in establishing membrane curvature .

  • Transmembrane Domain: The presence of a membrane anchor is conserved, though the specific sequence appears less critical, as functional complementation experiments demonstrate .

In Sclerotinia sclerotiorum, the Fcj1 ortholog would be expected to maintain these key structural features, though fungal-specific adaptations might exist. Comparative genomic analyses of mitofilin-family proteins across fungi could reveal lineage-specific innovations that might correlate with ecological niches or pathogenic lifestyles.

What emerging technologies could advance our understanding of Fcj1 and crista junction dynamics?

Several cutting-edge technologies hold promise for deeper insights into Fcj1 function:

  • Cryo-Electron Tomography: This technique allows visualization of macromolecular complexes in their native cellular environment at near-atomic resolution, potentially revealing the precise arrangement of Fcj1 molecules at CJs.

  • Super-Resolution Microscopy: Techniques such as STORM or PALM could enable live-cell imaging of CJ dynamics with unprecedented spatial resolution, allowing visualization of protein rearrangements during mitochondrial morphology changes.

  • Proximity Labeling Proteomics: Methods like BioID or APEX2 could identify proteins in close proximity to Fcj1 in vivo, potentially revealing novel interaction partners specific to fungal systems.

  • CRISPR-Based Genetic Manipulation: More efficient gene editing in filamentous fungi could facilitate systematic structure-function studies of Fcj1 in S. sclerotiorum.

  • Mitochondrial Metabolomics: Coupling structural studies with comprehensive metabolomic analysis could reveal how Fcj1-dependent architectural changes influence metabolic functions relevant to pathogenicity.

What are the challenges in translating research findings from yeast to pathogenic fungi like S. sclerotiorum?

Several challenges must be addressed when extending Fcj1 research from yeast to S. sclerotiorum:

  • Genetic Tractability: While S. cerevisiae has highly efficient transformation and genetic manipulation systems, similar work in filamentous fungi can be more challenging, requiring optimization of transformation protocols and selection systems.

  • Growth and Life Cycle Differences: S. sclerotiorum has a complex life cycle including vegetative growth, sclerotia formation, and sexual reproduction, each potentially involving different mitochondrial states not present in unicellular yeast.

  • Host Interaction Context: As a plant pathogen, S. sclerotiorum mitochondria function within the context of host-pathogen interactions, potentially facing selective pressures absent in free-living yeast.

  • Technical Challenges in Microscopy: The hyphal growth pattern and larger cell size of S. sclerotiorum present different challenges for high-resolution imaging compared to yeast cells.

  • Protein Conservation Issues: While core functions may be conserved, species-specific adaptations in Fcj1 structure or regulation might necessitate different experimental approaches to fully understand its function in S. sclerotiorum.

Addressing these challenges will require interdisciplinary approaches combining expertise in fungal genetics, cell biology, biochemistry, and plant pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.