Recombinant Sclerotinia sclerotiorum Golgi apparatus membrane protein tvp38 (tvp38)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Sclerotinia sclerotiorum Tvp38 is a full-length, His-tagged protein expressed in E. coli, designed to study the role of Tvp38 in fungal Golgi membrane dynamics . This protein is associated with vesicle transfer processes at the Golgi apparatus, a critical organelle for secretory pathway function .

Role in Vesicular Trafficking

Tvp38 homologs in yeast (Saccharomyces cerevisiae) and other eukaryotes are implicated in:

  • Golgi compartment organization: Localizes to Tlg2-marked vesicles, suggesting involvement in late Golgi transport .

  • Cargo selection: Potential role in sorting or retaining Golgi-resident enzymes like mannosyltransferases .

Research Applications

  • Proteomic studies: Used to map interactions with effectors like Ss-Sl2 or autophagy-related proteins (e.g., SsATG8) .

  • Functional assays: Silencing or overexpression experiments to assess impacts on vesicle transport or fungal virulence .

  • Host-pathogen interactions: Investigated in plant models (e.g., sunflower, Brassica) to identify virulence mechanisms .

Technical Notes

  • Reconstitution: Solubilize in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Avoid repeated freeze-thaw cycles: Aliquot for long-term storage .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments default to standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
tvp38; SS1G_04221; Golgi apparatus membrane protein tvp38
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
tvp38
Target Protein Sequence
MPADYSSTARALALPISPLESPPSSPIQHAERPPWSRRISSGVRRAYNSASPYSSQPTTS FKDQILRKADKLQRKCITAWQNLSTLQKCLAIVAAILNIVLVALFLVYQHQIFASLAPFA ERWRDLPGGWMILWAMTFVAAFPPLIGYSSTITIAGFVYGVPKGWAIVATSTVAGSTCSF LASRTILSTYVHRLVGKDKRFEALALTLKHDGIKILCMIRLCPLPYSLSNAAVATFPTVH PLNYALATALVTPKLFIHVFIGSRLGSLAGNEGMDTSTKMINYASIVIGGGLGATVGYII YQRTMARAKELEIEELEAANGDVAPGRRVAAEYSDANNDDAALMNDDDISLWDNTDEPAR YTDFVDEDEANVFASGDLDEEADIGGRGKMTRT
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking and spindle migration.
Database Links
Protein Families
TVP38/TMEM64 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is TVP38 protein and what is its significance in fungal systems?

TVP38 (Tlg2-compartment vesicle protein of 38 kDa) is a transmembrane protein first identified in Saccharomyces cerevisiae Golgi subcompartment membrane fractions. The protein is conserved across fungi and higher eukaryotes, including humans, suggesting important evolutionary functions in membrane transport mechanisms. Although not essential for growth under laboratory conditions in yeast, its co-localization with proteins involved in vesicular membrane trafficking suggests critical functions in membrane transport processes. TVP38 homologs belong to the DedA protein family in bacteria and are present in diverse organisms including cyanobacteria and plants. The protein likely plays roles in cargo selection during vesicle formation and transport, contributing to the integrity of membrane systems .

What is Sclerotinia sclerotiorum and why is it important in plant pathology research?

Sclerotinia sclerotiorum is a cosmopolitan fungal pathogen that causes Sclerotinia stem rot or white mold disease. This pathogen has exceptional agricultural significance due to its ability to infect more than 400 plant species, leading to substantial yield losses in major crops annually. The fungus produces survival structures called sclerotia (black, hard, irregular-shaped structures with pink to white centers) that can persist in soil for many years. Under moist and cool conditions (below 70°F), these structures germinate to produce apothecia, which release ascospores that infect plants, primarily through aging flower blossoms. This infection pathway has made S. sclerotiorum a model organism for studying plant-pathogen interactions and developing biological control strategies .

How do TVP38-like proteins function in membrane organization across different biological systems?

TVP38-like proteins appear to play crucial roles in organizing and stabilizing internal membrane systems across diverse organisms. In eukaryotes, the protein is associated with vesicle transfer processes at the Golgi membrane. In cyanobacteria, TVP38/DedA homologs are implicated in maintaining thylakoid membrane integrity. This is supported by the observation that Gloeobacter violaceus, the only cyanobacterium without an internal thylakoid membrane system, also lacks the Slr0305-homologous protein found in other cyanobacteria. The absence of this protein in Gloeobacter correlates with the absence of thylakoid membranes, suggesting a functional link between TVP38/DedA proteins and thylakoid membrane organization. In chloroplasts, the single TVP38 homolog likely participates in similar processes relating to thylakoid membrane structure maintenance or facilitating transport between the inner envelope membrane and thylakoid membranes .

How can researchers effectively isolate and purify TVP38 protein for functional studies?

While the search results don't provide specific protocols for TVP38 isolation, the approach would follow standard recombinant protein techniques with modifications for membrane proteins. Researchers should consider:

  • Gene cloning: Amplify the tvp38 gene from S. sclerotiorum genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Expression system selection: Choose between bacterial (E. coli), yeast, or insect cell expression systems based on protein complexity and post-translational modification requirements.

  • Fusion tags: Incorporate affinity tags (His-tag, GST, etc.) to facilitate purification.

  • Membrane protein extraction: Use specialized detergents (DDM, LDAO, etc.) to solubilize the membrane protein without denaturation.

  • Purification strategy: Employ affinity chromatography followed by size exclusion chromatography.

  • Verification: Confirm protein identity and purity using mass spectrometry, Western blotting, and functional assays.

For recombinant expression in fungi, techniques similar to those used for hypovirus studies could be adapted, where full-length cDNA cloning and in vitro transcription have been successfully employed .

What are the most effective methods for studying TVP38 subcellular localization in fungal systems?

For investigating TVP38 subcellular localization in fungi like S. sclerotiorum, researchers should consider:

  • Fluorescent protein tagging: Generate recombinant S. sclerotiorum expressing TVP38 fused with GFP or other fluorescent proteins to visualize its location using confocal microscopy.

  • Immunofluorescence microscopy: Develop specific antibodies against TVP38 and use these with fluorophore-conjugated secondary antibodies for localization studies.

  • Co-localization studies: Combine TVP38 detection with markers for different cellular compartments (Golgi, ER, vesicles) to determine precise localization.

  • Subcellular fractionation: Isolate different membrane fractions followed by Western blotting to detect the presence of TVP38.

  • Immuno-electron microscopy: For high-resolution localization, use gold-labeled antibodies against TVP38 and examine with transmission electron microscopy.

These approaches should be validated through multiple complementary methods to ensure accuracy, as protein overexpression can sometimes lead to mislocalization artifacts.

How can researchers effectively generate recombinant S. sclerotiorum strains expressing modified TVP38?

To generate recombinant S. sclerotiorum strains with modified TVP38, researchers can adapt protocols similar to those used for virus transfection in this fungus:

  • Gene targeting construct design: Design constructs containing the modified tvp38 gene with appropriate promoter and terminator sequences, plus a selectable marker.

  • Transformation method selection: Options include polyethylene glycol (PEG)-mediated protoplast transformation, Agrobacterium-mediated transformation, or biolistic delivery.

  • Protoplast preparation: Digest fungal cell walls with enzymes like lysing enzymes or Novozym 234 to generate protoplasts.

  • Selection strategy: Use appropriate antibiotics or herbicides based on the resistance marker in the construct.

  • Verification: Confirm integration using PCR, Southern blotting, and expression analysis through RT-PCR or Western blotting.

  • Phenotypic characterization: Examine growth, morphology, and virulence of the recombinant strains.

These approaches can be informed by successful recombinant strategies demonstrated with SsHV2L virus where in vitro transcripts were synthesized and transfected into virus-free isolates of S. sclerotiorum with measurable phenotypic outcomes .

What is the relationship between TVP38 function and fungal virulence in plant pathogenic fungi?

The relationship between TVP38 function and fungal virulence represents an important research frontier. While direct evidence linking TVP38 to S. sclerotiorum virulence is not explicitly detailed in the search results, several hypotheses can be formulated based on TVP38's proposed functions:

  • Secretion of virulence factors: If TVP38 facilitates vesicle trafficking and cargo selection, it may be involved in the secretion of enzymes and effector proteins necessary for plant infection and colonization.

  • Membrane remodeling during infection: During host invasion, fungal pathogens undergo significant membrane remodeling. TVP38 might participate in these processes, potentially affecting infection structures development.

  • Stress response: Plant defense responses often involve oxidative stress; TVP38 might contribute to membrane stability during these challenges.

To investigate these relationships, researchers could generate tvp38 knockout or knockdown strains in S. sclerotiorum and assess changes in virulence on host plants. Complementation studies with wild-type and mutated versions of the tvp38 gene would help confirm specific functional domains important for virulence. Additionally, comparative transcriptomics between virulent and hypovirulent strains may reveal correlations between tvp38 expression and pathogenicity .

How does the function of TVP38 in S. sclerotiorum compare to its homologs in other organisms?

TVP38 homologs appear across diverse organisms with varying degrees of functional conservation and specialization:

  • Yeast and higher eukaryotes: TVP38 is involved in vesicle transfer processes at the Golgi membrane, potentially participating in cargo selection during vesicle formation.

  • Chloroplasts: A single TVP38 homolog likely functions in maintaining thylakoid membrane structure or mediating transport between envelope and thylakoid membranes.

  • Cyanobacteria: Multiple homologs (e.g., Slr0232, Slr0305, and Slr0509 in Synechocystis) may have diversified functions related to thylakoid membrane organization.

  • Bacteria: As members of the DedA protein family, they function in membrane structure stabilization and organization.

The evolutionary conservation of this protein family despite functional diversification suggests fundamental roles in membrane biology. Comparative analysis of TVP38 across these systems reveals that while core functions in membrane organization appear conserved, specific roles have likely adapted to the particular membrane systems of each organism. This evolutionary plasticity makes TVP38 an interesting subject for understanding how membrane proteins adapt to different cellular contexts .

What potential interactions exist between TVP38 and mycoviruses like SsHV2L?

While direct interactions between TVP38 and mycoviruses are not explicitly documented in the search results, several hypothetical connections can be proposed for future research:

  • Membrane remodeling during viral replication: Mycoviruses like SsHV2L may utilize or manipulate host membrane systems, including TVP38-associated pathways, for their replication complexes.

  • Vesicular transport of viral components: If TVP38 mediates vesicle trafficking, it might influence the intracellular movement of viral components.

  • Host-virus protein interactions: TVP38 could potentially interact with viral proteins, either facilitating or restricting viral replication.

  • Impact on hypovirulence: Since SsHV2L infection induces hypovirulence in S. sclerotiorum, and if TVP38 influences virulence, there may be functional connections between viral infection and TVP38-dependent pathways.

To investigate these potential interactions, researchers could employ co-immunoprecipitation, yeast two-hybrid assays, or proximity labeling approaches to identify direct protein-protein interactions. Additionally, comparing TVP38 expression and localization in virus-infected versus virus-free fungal isolates could reveal whether viral infection alters TVP38 dynamics .

What genetic manipulation techniques are most effective for studying TVP38 function in S. sclerotiorum?

For genetic manipulation of TVP38 in S. sclerotiorum, researchers should consider these approaches:

  • CRISPR-Cas9 gene editing: Design specific sgRNAs targeting the tvp38 gene to create precise knockouts or targeted mutations.

  • RNAi-mediated gene silencing: Develop hairpin constructs targeting tvp38 transcript for post-transcriptional silencing.

  • Promoter replacement: Substitute the native promoter with inducible promoters to control expression levels.

  • Complementation analysis: Reintroduce wild-type or mutated versions of tvp38 into knockout strains to assess functional domains.

  • Homologous recombination: Traditional approach using flanking sequences for targeted gene replacement.

Each approach has specific advantages depending on the research question. For example, CRISPR-Cas9 offers precision for studying essential genes through conditional mutations, while RNAi allows analysis of partial loss-of-function phenotypes. When designing experiments, researchers should account for S. sclerotiorum's multinucleate nature, which can complicate the generation of homokaryotic mutants.

What proteomics approaches can reveal TVP38's interaction partners in fungal systems?

To identify TVP38 interaction partners in S. sclerotiorum, the following proteomics approaches would be most informative:

  • Affinity purification-mass spectrometry (AP-MS): Express tagged versions of TVP38 in S. sclerotiorum, isolate the protein complexes via affinity purification, and identify interacting partners using mass spectrometry.

  • Proximity-dependent biotin identification (BioID): Fuse TVP38 with a biotin ligase to biotinylate proximal proteins, which can then be purified and identified.

  • Cross-linking mass spectrometry (XL-MS): Use chemical cross-linkers to stabilize transient protein-protein interactions before purification and analysis.

  • Co-immunoprecipitation with specific antibodies: Develop antibodies against TVP38 to pull down native protein complexes.

  • Yeast two-hybrid screening: Although less physiologically relevant, this approach can identify direct binary interactions using a cDNA library from S. sclerotiorum.

These techniques should be complemented with validation approaches such as co-localization studies, pull-down assays, and functional analyses of identified interaction partners. Special consideration should be given to membrane protein extraction conditions to maintain native interactions .

How might understanding TVP38 function contribute to developing biological control strategies for S. sclerotiorum?

Understanding TVP38 function could contribute to biological control strategies in several ways:

  • Novel target identification: If TVP38 proves essential for virulence or stress adaptation, it could represent a new target for antifungal compounds or biocontrol strategies.

  • Engineered mycoviruses: Knowledge of TVP38's potential interactions with mycoviruses like SsHV2L could inform the development of recombinant mycoviruses specifically designed to disrupt TVP38 function and reduce fungal virulence.

  • Molecular diagnostics: TVP38-based markers might help identify strain variations in field populations, informing disease management decisions.

  • Host resistance engineering: If TVP38 interacts with specific plant defense mechanisms, this knowledge could guide breeding programs or transgenic approaches to enhance crop resistance.

The successful demonstration that SsHV2L infection induces hypovirulence in S. sclerotiorum provides a conceptual framework for exploiting fungal proteins and their interactions with mycoviruses to reduce white mold disease severity. If TVP38 influences these virus-host interactions, it could represent a promising intervention point .

What methodological approaches can assess the impact of TVP38 modification on fungal virulence in planta?

To evaluate how TVP38 modifications affect S. sclerotiorum virulence in plants, researchers should employ these methodological approaches:

  • Detached leaf assays: Inoculate detached leaves from host plants with wild-type and TVP38-modified strains to quantify lesion development.

  • Whole plant pathogenicity tests: Conduct greenhouse or growth chamber studies using standardized inoculation methods on key host plants like soybean and lettuce.

  • Tissue-specific colonization analysis: Use microscopy with fluorescently labeled fungal strains to track colonization patterns and differences between wild-type and modified strains.

  • Virulence factor secretion assays: Quantify secreted enzymes (pectinases, cellulases) from wild-type and TVP38-modified strains to assess impact on virulence factor production.

  • Sclerotia formation and viability assessment: Evaluate the number, size, and germination capacity of sclerotia produced by modified strains.

The experimental approach used for SsHV2L, where virus-transfected S. sclerotiorum isolates were evaluated for hypovirulence on soybean and lettuce along with assessment of sclerotia maturation, provides a valuable methodological template. Similar assessments could be applied to TVP38-modified strains to determine their impact on the fungal disease cycle .

What emerging technologies could advance our understanding of TVP38 dynamics in living cells?

Several cutting-edge technologies could significantly enhance our understanding of TVP38 dynamics:

  • Super-resolution microscopy: Techniques like STORM, PALM, or STED microscopy could provide nanoscale visualization of TVP38 localization and dynamics beyond the diffraction limit of conventional microscopy.

  • Live-cell single-molecule tracking: Following individual TVP38 molecules tagged with photoactivatable fluorescent proteins to map movement and interactions in real-time.

  • Optogenetics: Engineering light-sensitive domains into TVP38 to enable spatiotemporal control of its function for precise mechanistic studies.

  • Cryo-electron tomography: Capturing high-resolution 3D structures of TVP38 in its native membrane environment.

  • Mass spectrometry imaging: Analyzing the spatial distribution of TVP38 and associated molecules within fungal cells and infection structures.

These technologies could provide unprecedented insights into how TVP38 functions dynamically during vesicle formation, membrane organization, and potential roles during host infection processes.

What comparative genomics approaches might reveal about TVP38 evolution and specialization across fungal pathogens?

Comparative genomics approaches to study TVP38 evolution could include:

  • Phylogenetic analysis: Constructing comprehensive evolutionary trees of TVP38 homologs across diverse fungi to identify patterns of conservation and divergence.

  • Selection pressure analysis: Calculating dN/dS ratios to identify regions under positive or purifying selection.

  • Domain architecture comparison: Analyzing differences in protein domains between TVP38 homologs in different pathogenic fungi versus saprotrophs.

  • Synteny analysis: Examining the genomic context of tvp38 genes across species to identify conserved gene neighborhoods that might suggest functional associations.

  • Correlation with pathogenicity: Mapping TVP38 sequence variations against host range and virulence characteristics across fungal species.

These approaches could reveal whether TVP38 has undergone specialized adaptation in plant pathogens like S. sclerotiorum compared to non-pathogenic relatives, potentially identifying key residues or domains associated with pathogenicity functions. The observed recombination in viral systems suggests that genomic plasticity is an important evolutionary mechanism in these pathosystems, potentially extending to host proteins as well .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.