Recombinant Sclerotinia sclerotiorum Mitochondrial outer membrane protein iml2 (iml2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
iml2; SS1G_01103; Inclusion body clearance protein iml2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-645
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
iml2
Target Protein Sequence
MSRWFKSAVKATPAMVAESEEQHLRDVEAAMLKLLNDDIEEADKLLKKHDSSYHHLGRGI
SGFLSAMMGVEKDLLKEAAVILQDAENKSWDDMKKAQKDSTAFQSNIYPQGTEYLLCYSV
AQLTSAITAVLSGSITEAVKGFYKLRKAYLTLDGILEVENKYLEKIAHSSTTSLSSRTPS
HKSSMAALTVDEIAHRTADLSVGDLDEKMLDPNNPYPNISRPPSPPSVTNPYDIDPELAA
RVFTNRTDIFIHSGVRLCCGLLLLVFSMIENPIFNKILYIVGFKGDRERGTRLLWQATRY
QNFNSAIAALALLGYYNGLVGFCDILPTDDAADDNPTGYPKNKCQALLVDMQSRYPHSKL
WKLEEARMLSYKQDLKGALVILEENSKSKMKQITMINTFEMALTTLFIHEYEKSATAWIN
CSEQSAWSPTLYFYIAGISYVELYRNTRLSDPAAAEVHKKKAIEFILKAPPLAGKQKVMA
KQLPFDIYIVSKVGKWEQRAKAWGVDLVDAIGPSPFVEMIYFWNGVKKSGTVELEKCLDL
LKKERMTCPEKCNEDEEDVAIHLLLRGSCCSWREKDLPPGGDSTSGEKMSEKKLLEYRRE
KLMDCEEKLLKLHSWPQTYVFETRMSFKISTSLLTVKRHKGLMGF
Uniprot No.
Target Background
Function
This inclusion body (IB)-resident protein exhibits strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearance following protein folding stress, likely by facilitating access to IBs of an LD-stored, soluble sterol derivative functioning as a chaperone in inclusion clearing.
Database Links
KEGG: ssl:SS1G_01103
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
