Recombinant Sclerotinia sclerotiorum NADH-cytochrome b5 reductase 2 (mcr1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sclerotinia sclerotiorum NADH-Cytochrome b5 Reductase 2 (mcr1)

Recombinant Sclerotinia sclerotiorum NADH-cytochrome b5 reductase 2 (mcr1) is a recombinant protein derived from the fungus Sclerotinia sclerotiorum, a pathogen known for causing Sclerotinia stem rot in various plant species. This enzyme plays a crucial role in the electron transport chain, facilitating the reduction of cytochrome b5 using NADH as an electron donor. The recombinant form of this enzyme is produced through genetic engineering techniques, often in bacterial systems like Escherichia coli, to study its biochemical properties and potential applications.

Biochemical Characteristics

  • Enzyme Function: NADH-cytochrome b5 reductase is involved in transferring electrons from NADH to cytochrome b5, which is essential for various cellular processes, including fatty acid desaturation and elongation.

  • Protein Structure: The recombinant protein typically includes a His-tag for easy purification and is expressed as a full-length protein. For Sclerotinia sclerotiorum, the protein sequence spans approximately 345 amino acids .

  • Expression System: Commonly expressed in E. coli due to its efficient protein production capabilities.

Pathogenic Role in Plants

Sclerotinia sclerotiorum is a necrotrophic pathogen that infects a wide range of plant species, causing significant economic losses. The study of its enzymes, including NADH-cytochrome b5 reductase, can provide insights into the pathogen's metabolism and potential targets for disease management.

Biochemical Studies

Recombinant NADH-cytochrome b5 reductase 2 (mcr1) from Sclerotinia sclerotiorum can be used to investigate the enzyme's kinetic properties, substrate specificity, and interactions with other proteins in the electron transport chain.

Potential Biotechnological Applications

Understanding the biochemical pathways involving this enzyme could lead to the development of novel biotechnological tools, such as improved methods for fatty acid modification or enhanced plant resistance to pathogens.

Amino Acid Sequence

The amino acid sequence of the recombinant protein from Sclerotinia sclerotiorum is crucial for understanding its structure and function. The sequence provided includes key motifs involved in enzyme activity and protein-protein interactions .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -210°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcr1; SS1G_05932; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-345
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
mcr1
Target Protein Sequence
MFARQTLRAAQPFRSQYRRYATESSSSGSNTALYTGVAAAVAGAGYYFMSQGDNAAKVKD AAKDAEAKAKEALGQGQAKVEGAVGKAAFTGGDQGFISLKLDSVELVNHNTKKFRFELPE SDQVSGLHVTSALITKYKGPEMQKPAIRPYTPTSDEGEKGFIDLLVKKYPNGVMSEHMHE MVPGQRLDFKGPIPKYAWSANKHDHIALIAGGTGITPMYQLARAIFNNPADKTKVTLVFA NVTEEDILLKREFEDLENTYPQRFRAFYVLDNPPKSWKGGKGFINKELLKTVLPEPKSEN IKLFVCGPPGMYKAISGGKVSPSDQGELAGILKELGYSKDQVYKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is NADH-cytochrome b5 reductase and what is its significance in fungal systems?

NADH-cytochrome b5 reductase (CbR) represents a critical class of enzymes involved in electron transport chains across various organisms. In fungal systems, CbRs function primarily as electron donors using NADH preferentially over NADPH. Based on studies in other fungi, these enzymes typically contain a flavin-binding β-barrel domain with three highly conserved amino acid residues (arginine, tyrosine, and serine) that form hydrogen bonds with flavin, a prosthetic group essential for electron transfer .

In mitochondria of yeast (Saccharomyces cerevisiae), a homologous protein called MCR1 exists in two forms: one anchored to the outer membrane and another inserted into the membrane after digestion of the N-terminal membrane-bound domain . While specific functions vary across species, these enzymes generally participate in various redox processes essential for fungal metabolism and potentially pathogenicity.

How does S. sclerotiorum generate and manage oxidative stress during infection?

S. sclerotiorum infects host plant tissues by inducing necrosis, which allows the pathogen to source nutrients needed for establishment. This tissue necrosis results from enhanced generation of reactive oxygen species (ROS) at infection sites, leading to apoptosis . To counter host-induced oxidative damage, S. sclerotiorum has evolved sophisticated ROS scavenging mechanisms .

Studies of oxidative stress response genes like Thioredoxin1 (SsTrx1) have shown that these mechanisms are crucial for pathogenicity. RNA interference-induced silencing of SsTrx1 affected hyphal growth rate, mycelial morphology, and sclerotial development, confirming its involvement in promoting pathogenicity and oxidative stress tolerance . By analogy, NADH-cytochrome b5 reductase may play a similar role in managing oxidative stress during the infection process.

What homologous systems to mcr1 have been characterized in other fungi?

The most well-characterized homologous system is from Mortierella alpina, where a CbR gene was identified using sequence information from bovine and yeast NADH-cytochrome b5 reductases. This gene encodes a protein of 298 amino acid residues with marked sequence similarity to CbRs from yeast, bovine, human, and rat sources .

In S. cerevisiae, two distinct types have been reported: CBR, a putative CbR with similarity to both plant nitrate reductases and mammalian CbRs that is essential for yeast viability; and MCR1, which localizes to mitochondria in two forms as described earlier . These characterized systems provide valuable templates for investigating potential homologs in S. sclerotiorum.

What approaches can be used to identify and characterize NADH-cytochrome b5 reductase genes in S. sclerotiorum?

Researchers can employ several complementary approaches:

  • Homology-based identification: Using known CbR sequences from related fungi as probes to identify potential homologs through BLAST searches of the S. sclerotiorum genome. This approach was successfully used to identify CbR in M. alpina using bovine and yeast CbR sequences .

  • PCR-based cloning: Design primers based on conserved regions of CbRs from other fungi to amplify potential homologs from S. sclerotiorum genomic DNA or cDNA libraries .

  • Transcriptome analysis: Examine gene expression profiles under various conditions, particularly during infection, to identify upregulated genes with sequence similarity to known CbRs .

  • Functional screening: Express candidate genes in heterologous systems like Aspergillus oryzae and assess NADH-ferricyanide reductase activity, similar to the 4.7-fold increase observed when expressing M. alpina CbR in A. oryzae .

How does enzyme activity of fungal NADH-cytochrome b5 reductase compare with other eukaryotic homologs?

Fungal NADH-cytochrome b5 reductases exhibit several distinct characteristics compared to their mammalian counterparts. The M. alpina CbR shows strong preference for NADH over NADPH as an electron donor, similar to mammalian CbRs . Studies of purified M. alpina CbR demonstrated NADH-ferricyanide reductase activity that could be significantly enhanced (645-fold increase) through optimized purification protocols .

What are effective strategies for cloning and expressing recombinant NADH-cytochrome b5 reductase from S. sclerotiorum?

Based on successful approaches with related enzymes, researchers should consider:

  • PCR amplification: Design primers based on conserved regions identified through sequence alignment of known fungal CbR genes. For M. alpina, researchers successfully used this approach with primers designed from bovine and yeast CbR sequences .

  • Expression system selection: Filamentous fungi like A. oryzae have proven effective for expressing fungal CbRs. When M. alpina CbR was expressed in A. oryzae, it resulted in a 4.7-fold increase in ferricyanide reduction activity .

  • Vector design: Include appropriate fungal promoters and signal sequences to ensure efficient expression and correct subcellular localization.

  • Purification strategy: Following the M. alpina model, consider solubilization of microsomes with cholic acid sodium salt, followed by sequential chromatography using DEAE-Sephacel, Mono-Q HR 5/5, and AMP-Sepharose 4B affinity columns .

  • Activity verification: Use NADH-ferricyanide reductase assays to confirm functional expression of the recombinant protein .

How can RNA interference or gene knockout approaches be optimized for studying NADH-cytochrome b5 reductase function in S. sclerotiorum?

RNA interference (RNAi) has been successfully applied to study gene function in S. sclerotiorum, as demonstrated with SsTrx1 . For investigating NADH-cytochrome b5 reductase:

  • Construct design: Design RNAi constructs targeting conserved regions of the gene while ensuring specificity to avoid off-target effects.

  • Transformation: Optimize Agrobacterium-mediated transformation protocols for S. sclerotiorum to achieve efficient delivery of RNAi constructs.

  • Verification: Confirm gene silencing through RT-PCR and Western blot analysis to quantify reduction in transcript and protein levels.

  • Phenotypic analysis: Systematically evaluate effects on hyphal growth, mycelial morphology, sclerotial development, and pathogenicity on host plants, similar to approaches used with SsTrx1 .

  • Host-induced gene silencing (HIGS): Consider developing HIGS vectors for expression in host plants, as was done with SsTrx1 in Arabidopsis thaliana and Nicotiana benthamiana, which significantly reduced pathogenicity and disease progression .

What assays can be used to measure NADH-cytochrome b5 reductase activity in fungal samples?

Several reliable assays can be employed:

  • NADH-ferricyanide reductase assay: This is a standard approach for measuring CbR activity, where the reduction of ferricyanide is measured spectrophotometrically in the presence of NADH .

  • Cytochrome c reduction assay: Measuring the rate of cytochrome c reduction in the presence of NADH and purified or crude enzyme preparations.

  • Differential substrate utilization: Compare activity with NADH versus NADPH to confirm substrate preference characteristic of CbRs .

  • Inhibitor studies: Use specific inhibitors to confirm the identity of the enzyme activity being measured.

  • In-gel activity assays: For qualitative assessment of activity following native gel electrophoresis.

Assay TypePrincipleAdvantagesLimitations
NADH-ferricyanide reductaseMeasures reduction of ferricyanide spectrophotometricallyHigh sensitivity, well-establishedMay detect other reductases
Cytochrome c reductionMeasures reduction of cytochrome cPhysiologically relevantMore complex setup
Differential substrate utilizationCompares NADH vs. NADPH activityHelps confirm enzyme identityRequires pure enzyme preparations
Inhibitor studiesUses specific inhibitors to confirm identityHelps rule out non-specific activityRequires specific inhibitors
In-gel activityVisualizes activity after native PAGECan separate isoformsQualitative rather than quantitative

How can homology modeling be used to predict the structure of S. sclerotiorum NADH-cytochrome b5 reductase?

Homology modeling provides a powerful approach for predicting protein structure when experimental structures are unavailable:

  • Template selection: Identify suitable templates from structurally characterized CbRs, prioritizing those with highest sequence identity to the S. sclerotiorum enzyme. The flavin-binding β-barrel domains of CbRs from various species share similar folding patterns .

  • Sequence alignment: Generate accurate alignments between the target sequence and template structures, paying particular attention to conserved motifs like the three highly conserved amino acid residues (arginine, tyrosine, and serine) involved in flavin binding .

  • Model building: Generate three-dimensional models using specialized software, focusing on the spatial arrangement of conserved residues involved in flavin binding and catalysis.

  • Model validation: Assess model quality using metrics like RMSD, Ramachandran plots, and QMEAN scores.

  • Functional prediction: Based on the model, predict residues likely involved in NADH binding, flavin binding, and electron transfer, which can guide future site-directed mutagenesis experiments.

What statistical approaches are most appropriate for analyzing differential expression of NADH-cytochrome b5 reductase genes under various conditions?

For robust analysis of differential expression:

  • Experimental design: Include biological replicates (minimum 3-4) and appropriate controls for each condition tested.

  • Normalization methods: Apply appropriate normalization to account for technical variations between samples, using reference genes that maintain stable expression across conditions.

  • Statistical tests: For pairwise comparisons, use t-tests with appropriate corrections for multiple testing (e.g., Benjamini-Hochberg procedure). For multiple conditions, apply ANOVA followed by post-hoc tests.

  • Fold-change analysis: Beyond statistical significance, consider biological significance by evaluating fold-changes in expression. Studies of SsTrx1 observed significant induction during infection , providing a model for expression analysis.

  • Correlation analysis: Examine correlations between expression patterns of NADH-cytochrome b5 reductase and other genes known to be involved in pathogenicity, such as SsTrx1 or SsC6TF1 .

Could NADH-cytochrome b5 reductase be a viable target for developing fungicides against S. sclerotiorum?

The potential of NADH-cytochrome b5 reductase as a fungicide target depends on several factors:

How does mcr1 fit into our broader understanding of S. sclerotiorum pathogenicity mechanisms?

S. sclerotiorum pathogenicity involves a complex network of factors:

  • Oxidative stress management: Like SsTrx1, which is crucial for oxidative stress tolerance , NADH-cytochrome b5 reductase likely contributes to redox homeostasis during infection.

  • Integration with known pathogenicity factors: S. sclerotiorum virulence involves oxalic acid, effectors, cell-wall degrading enzymes, and transcription factors like SsC6TF1 . Understanding how NADH-cytochrome b5 reductase interacts with these known factors would provide a more comprehensive picture of pathogenicity.

  • Developmental regulation: Many genes involved in S. sclerotiorum pathogenicity also regulate growth and development. For example, SsC6TF1 knockdown affected sclerotial development and reduced virulence , while SsCak1 deletion caused defects in mycelium and sclerotia development, appressoria formation, and host penetration .

  • Metabolic support: NADH-cytochrome b5 reductase likely supports key metabolic processes required during the energy-intensive infection process.

What emerging technologies could enhance our understanding of electron transport proteins in fungal plant pathogens?

Several cutting-edge approaches show promise:

  • Cryo-electron microscopy: For high-resolution structural analysis of membrane-associated proteins like NADH-cytochrome b5 reductase, potentially revealing conformational changes during electron transport.

  • CRISPR-Cas9 genome editing: For precise manipulation of genomic loci to study gene function and create conditional mutants when complete deletion is lethal.

  • Single-cell transcriptomics: To characterize cell-specific expression patterns within fungal infection structures.

  • Metabolic flux analysis: To quantify how alterations in NADH-cytochrome b5 reductase affect broader metabolic networks.

  • Host-induced gene silencing (HIGS): Already demonstrated for SsTrx1 and suggested for SsCak1 , HIGS could be applied to NADH-cytochrome b5 reductase to develop resistant crops.

  • Protein-protein interaction networks: Techniques like BioID or proximity labeling could identify interaction partners of NADH-cytochrome b5 reductase during infection.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.