Recombinant Sclerotinia sclerotiorum Plasma membrane fusion protein prm1 (prm1)

Shipped with Ice Packs
In Stock

Description

Key Features

PropertyDescription
SpeciesVanderwaltozyma polyspora
Expression SystemE. coli
TagN-terminal His tag
Protein LengthFull-length (1-659 amino acids)
Purification>90% purity (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Gene IDPRM1 (UniProt ID: A7TRZ7)

Sequence Highlights:

  • Contains conserved fungal membrane fusion domains.

  • Includes hydrophobic regions critical for membrane interaction.

Comparative Analysis with S. sclerotiorum Virulence Factors

S. sclerotiorum employs diverse secretory proteins for host invasion, such as SsCut1 (cutinase) and Ss-Rhs1 (Rhs repeat-containing protein), which are essential for virulence . Although PRM1’s role in S. sclerotiorum remains unstudied, membrane fusion proteins in related fungi often facilitate:

  • Host cell penetration (e.g., appressorium formation) .

  • Intercellular hyphal fusion during infection .

Research Gaps and Hypothetical Roles of PRM1 in S. sclerotiorum

While direct data on S. sclerotiorum PRM1 is absent, its putative functions could align with:

  1. Membrane Dynamics: Mediating hyphal fusion or organelle reorganization during infection.

  2. Pathogenicity: Synergizing with effector proteins like SSITL (integrin-like protein) or SsGH5 (glycosyl hydrolase) .

  3. Stress Adaptation: Supporting survival under host oxidative stress, akin to glutathione S-transferases in S. sclerotiorum .

Technical Considerations for Recombinant PRM1 Production

Based on Vanderwaltozyma PRM1 protocols :

  • Expression: Optimize codon usage for E. coli systems to enhance yield.

  • Purification: Use nickel-affinity chromatography for His-tagged proteins.

  • Stability: Avoid repeated freeze-thaw cycles; reconstitute in sterile water with 50% glycerol for long-term storage.

Future Directions

  1. Functional Studies: Knockout mutants of PRM1 in S. sclerotiorum to assess virulence impacts.

  2. Interaction Mapping: Screen for host targets using yeast two-hybrid assays.

  3. Biotechnological Applications: Explore PRM1 as a RNA silencing target for host-induced gene silencing (HIGS) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments default to blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please communicate them to us, and we will prioritize developing the specified tag.
Synonyms
prm1; SS1G_14299; Plasma membrane fusion protein prm1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-795
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
prm1
Target Protein Sequence
MDAFRGYLAAQKGQHNQAASNNPPFHSDHEMHHYGAHPNTNAAPADDYYTPYLGLRARLS QTWINRWTILLLLIIVRLLISLSTINGDIASAKTEALSACTSVENVGSAMASMPHYLSQG VNSMAAAGITKAVNGMMEMLYLTLTGVEEIVLFVIHMMTSTYMCLITLAITGSLQVAIQM IEDVGAFMNKSIDTITGDMSSGLKSFEDDLNGFLSKINIGGIFGSSTSPPKIDLSSEINK LNSIQIDPSTMDADLAKLNASLPTFDQVQNFTDSIIKLPFEEVKKLVNESKIGYKFDDSV FPVPQKKSLTFCSDNTAIQDFFIGLVKTLNIAKKIMLIVLIIAAILACVPMAYREIWGWR SMQRRAALLKAHNYTNELDILYQAHRPYTSQFGLKLSRRFKGQKNQILARWFIAYATSIP ALFVLALGMAGLFTCLCQFIILRTIEKEIPALAAEVGDFAEHVVQALNNASEAWALGANS VINNTNTDINENVFGWVNTTTGAINETLNVFTDEMTKALNVTFGGTILYKPIMGVFECLV GLKVAGIEKGLTWVSDHAHVEFPEFQPDVFSLGAAASLTNSTADDNFLANPATSTTDEIT DAVVKVGKKLEAVIKQEALISASLVIVYFVIVFIGFVRVVIGMCGRDKSRAEGGSGPGTL YRNGFPHQHLPVIREEKFGSNASDGWHEEHMRAGGDTIRMPFGGDGAADDLPYDGAPAPK YEASIAPVTTEMGSERLGVVPGGRANTNRGPWVRDEKGREGWEADDAQMRATSSYGFLEN GDEKSSGWGLPPRRV
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell fusion during mating by stabilizing the plasma membrane fusion event.
Database Links
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PRM1 in Sclerotinia sclerotiorum?

PRM1 in S. sclerotiorum, like its homologs in other fungi, is a transmembrane protein that promotes plasma membrane fusion during cell-to-cell interactions. Based on studies in related fungi, PRM1 is likely critical for membrane merger events during both vegetative growth and potentially during pathogenic interactions. When PRM1 is absent, a significant fraction of fusion pairs fail to merge their plasma membranes and remain with tightly adhered lipid bilayers . While S. sclerotiorum-specific PRM1 functions are still being characterized, its role appears consistent with the conserved functions observed across fungal species.

How does PRM1 differ structurally from other membrane fusion proteins in fungi?

PRM1 belongs to a distinct class of membrane fusion proteins that does not share significant structural homology with viral fusogens or SNARE proteins. The protein contains multiple transmembrane domains and is specifically recruited to the site of membrane contact during fusion events. Unlike some other fusion proteins, PRM1 is not sufficient on its own to drive membrane fusion, suggesting it works cooperatively with other factors like LFD-1 to facilitate the membrane merger process .

What is known about the expression pattern of prm1 during S. sclerotiorum infection cycles?

While the specific expression pattern of prm1 in S. sclerotiorum hasn't been fully characterized in the provided search results, transcriptome analyses of S. sclerotiorum during plant infection reveal significant differential expression of genes involved in membrane functions, oxidation-reduction processes, and signal transduction . Given that PRM1 functions in membrane fusion events, its expression is likely regulated during specific developmental stages, particularly during infection establishment and colony formation.

How does the absence of PRM1 affect membrane invagination formation during fusion attempts?

In PRM1-deficient strains (Δprm1) of fungi like Neurospora crassa, cell pairs that attempt to fuse develop characteristic membrane invaginations at contact sites. These invaginations represent arrested fusion intermediates where the plasma membranes remain tightly adhered but fail to merge. Microscopic analysis reveals that approximately 50% of Δprm1 cell pairs in N. crassa exhibit this phenotype . The formation of these structures suggests that PRM1 functions at a late stage in the fusion process, specifically during the lipid bilayer mixing step after cell wall degradation and membrane contact have occurred.

What is the relationship between PRM1 and calcium-dependent repair mechanisms during fusion-induced lysis?

PRM1-deficient cells show significantly increased rates of cell lysis during fusion attempts, which correlates with the moment of cytoplasmic mixture. This suggests that aberrant engagement of the fusion machinery results in membrane rupture and cell death. Importantly, fusion-induced lysis in Δprm1 mutants is enhanced by low levels of extracellular calcium ions (Ca²⁺), with lysis rates increasing from ~12% on regular medium to ~20% when calcium content is reduced by half . This calcium dependency indicates that Ca²⁺-dependent repair mechanisms normally counteract membrane instability during fusion, and these repair pathways become critical in the absence of PRM1.

How do sterols influence PRM1 function in membrane fusion?

Research on ergosterol biosynthesis mutants (Δerg-10a/Δerg-10b and Δerg-1) in Neurospora crassa has revealed that the structure of the sterol ring system specifically affects plasma membrane merger during fusion. Interestingly, the membrane fusion defects caused by altered sterol composition are independent of PRM1, as demonstrated by additive fusion defects in double and triple mutants . This suggests that sterols impact membrane fusion at a stage before PRM1 engagement, potentially by affecting membrane fluidity, domain organization, or the recruitment of other fusion factors to the contact site.

What are the optimal expression systems for producing recombinant S. sclerotiorum PRM1?

For recombinant expression of fungal membrane proteins like PRM1, several expression systems can be considered based on experimental objectives:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, low cost, rapidMay lack proper folding for complex membrane proteinsInitial protein domain studies
Pichia pastorisEukaryotic processing, high yieldLonger development timeFull-length functional studies
Neurospora expressionNative-like folding and modificationsLower yields, technically challengingComplementation studies
Baculovirus/insect cellsHigh-quality membrane protein productionHigher cost, technical complexityStructural studies

For S. sclerotiorum PRM1, a fungal expression system (preferably Neurospora or related ascomycetes) may provide the most physiologically relevant protein for functional studies, while bacterial systems might be suitable for producing protein fragments for antibody generation.

What microscopy techniques are most effective for visualizing PRM1 localization during membrane fusion?

Several microscopy approaches have proven effective for studying membrane fusion proteins in fungi:

  • Confocal laser scanning microscopy with GFP-tagged PRM1 allows for tracking protein localization in living cells during the fusion process.

  • Super-resolution techniques such as structured illumination microscopy (SIM) or stimulated emission depletion (STED) microscopy provide higher resolution images of PRM1 clustering at the fusion site.

  • Correlative light and electron microscopy (CLEM) enables visualization of both protein localization and membrane ultrastructure during fusion events.

  • For dynamic studies, spinning disk confocal microscopy with high temporal resolution can capture the recruitment and behavior of PRM1 during the fusion process.

The choice depends on the specific research question, with CLEM being particularly valuable for correlating PRM1 localization with membrane structural changes during fusion attempts .

How can researchers effectively generate and validate PRM1 knockout mutants in S. sclerotiorum?

Creating PRM1 knockout mutants in S. sclerotiorum requires:

  • CRISPR-Cas9 or homologous recombination approaches targeting the prm1 gene locus. For S. sclerotiorum, Agrobacterium-mediated transformation often yields higher efficiency.

  • Selection markers appropriate for filamentous fungi (hygromycin B or nourseothricin resistance).

  • PCR verification of gene deletion using primers flanking the target locus.

  • Confirmation of protein absence via Western blotting with PRM1-specific antibodies.

  • Phenotypic validation by quantifying:

    • Germling fusion frequencies (~50% reduction expected based on N. crassa data)

    • Formation of membrane invaginations at contact sites using FM4-64 membrane staining

    • Rates of fusion-induced cell lysis under normal and reduced calcium conditions

    • Virulence changes in plant infection assays, similar to methodology used for other S. sclerotiorum genes

  • Complementation with wild-type prm1 to confirm phenotype specificity.

How conserved is PRM1 function across different fungal species?

PRM1 function shows significant conservation across ascomycete fungi. Studies in Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Neurospora crassa demonstrate that PRM1 homologs in all three species mediate plasma membrane fusion, with mutants exhibiting similar defects in membrane merger . Despite this functional conservation, there are species-specific aspects:

  • In S. cerevisiae, PRM1 functions primarily during mating (sexual fusion).

  • In N. crassa, PRM1 mediates both vegetative and sexual fusion events.

  • The phenotypic similarities between N. crassa Δprm1 mutants during vegetative fusion and S. cerevisiae Δprm1 cells during mating suggest evolutionary connections between these processes.

This conservation indicates that recombinant S. sclerotiorum PRM1 would likely function similarly to its homologs, with potentially unique adaptations for this plant pathogen's lifestyle.

What is the relationship between PRM1 and LFD-1 in membrane fusion mechanisms?

PRM1 and LFD-1 operate in parallel pathways during membrane fusion. In N. crassa, these transmembrane proteins have independent and redundant roles:

  • LFD-1 deletion causes a milder fusion defect (~20% failure rate) compared to PRM1 deletion (~50% failure rate) .

  • Double mutants lacking both proteins show additive defects, confirming their independent functions.

  • Both proteins are susceptible to changes in membrane composition, but are differentially affected by alterations in sterol structure, suggesting they operate in distinct membrane environments or with different lipid dependencies .

  • Both contribute to preventing fusion-induced lysis, likely by stabilizing the fusion intermediate during membrane reorganization.

This redundancy may explain why single gene knockouts often show partial rather than complete fusion blocks, and suggests multiple parallel mechanisms ensuring successful membrane fusion in fungi.

How does PRM1 function potentially contribute to S. sclerotiorum virulence?

While direct evidence for PRM1's role in S. sclerotiorum virulence is limited in the provided search results, several inferences can be made based on fungal biology:

  • Efficient cell fusion is critical for fungal colony establishment and integrity, which indirectly impacts virulence potential.

  • During host infection, S. sclerotiorum undergoes significant differential gene expression, including genes involved in membrane functions and signal transduction , suggesting membrane-related proteins like PRM1 may be regulated during infection.

  • The ability to form a robust, interconnected hyphal network through fusion events may enhance the pathogen's ability to colonize host tissue and withstand defense responses.

  • Other membrane-related proteins in S. sclerotiorum, such as SsCP1, directly contribute to virulence by interacting with host defense proteins like PR1 , highlighting the importance of membrane-associated factors in pathogenicity.

A direct assessment of PRM1's contribution would require virulence assays comparing wild-type and Δprm1 S. sclerotiorum strains on host plants.

What experimental approaches would best determine if PRM1 interacts with host factors during infection?

To investigate potential interactions between S. sclerotiorum PRM1 and host factors:

  • Yeast two-hybrid screening using PRM1 extracellular domains as bait against host cDNA libraries, similar to methods used to identify SsCP1-PR1 interactions .

  • Co-immunoprecipitation (Co-IP) experiments using tagged PRM1 protein expressed in S. sclerotiorum during host infection, followed by mass spectrometry to identify interacting host proteins.

  • Bimolecular fluorescence complementation (BiFC) assays to visualize potential interactions in planta, by expressing PRM1 and candidate host proteins fused to complementary fragments of a fluorescent protein.

  • GST pull-down assays with recombinant PRM1 domains and plant protein extracts to identify direct physical interactions.

  • Transcriptome analysis comparing host responses to wild-type and Δprm1 S. sclerotiorum strains to identify differentially regulated defense pathways.

These approaches would reveal whether PRM1, like the SsCP1 protein, directly interacts with host factors or primarily functions in fungal development .

How might sterol composition differences between host and pathogen membranes affect PRM1 function during infection?

Research on ergosterol biosynthesis mutants reveals that sterol structure specifically affects membrane fusion events . This raises important considerations for host-pathogen interactions:

  • Plant membranes contain primarily sitosterol and stigmasterol, while fungal membranes contain ergosterol, creating distinct biophysical properties at interface points.

  • These sterol differences could create fusion barriers that PRM1 and other fusion machinery must overcome during host colonization.

  • Experimental approaches to investigate this might include:

    • Creating S. sclerotiorum strains with modified sterol synthesis pathways

    • Examining PRM1 localization and function at plant-fungal interface points

    • Testing if plant membrane sterols inhibit fungal fusion events

  • The specificity of sterol structure effects on defined cellular processes rather than general membrane disruption suggests potential for targeted intervention strategies that disrupt PRM1 function in the unique membrane environment of the host-pathogen interface.

What transcriptional regulatory mechanisms control prm1 expression during different growth phases and infection stages?

Understanding prm1 regulation requires:

  • Promoter analysis to identify transcription factor binding sites through in silico approaches and reporter gene assays.

  • Time-course transcriptome analysis during vegetative growth, sclerotia formation, and host infection to determine when prm1 is up- or down-regulated, similar to approaches used for other S. sclerotiorum genes .

  • Chromatin immunoprecipitation (ChIP) assays to identify transcription factors that bind the prm1 promoter under different conditions.

  • Gene expression analysis under various environmental stresses (oxidative, osmotic, temperature) to determine if prm1 responds to stress signaling pathways.

  • Comparison with expression patterns of other fusion-related genes (like lfd-1) to identify potential co-regulation mechanisms.

These approaches would reveal how S. sclerotiorum coordinates expression of its membrane fusion machinery during different developmental stages and infection processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.