Recombinant Sclerotinia sclerotiorum Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; SS1G_03945; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
get1
Target Protein Sequence
MPSLLFTCFLVQLLIHLVNTFGAATINNLLWNLYNMLPTPTSQSAGEQKKLKREYMKVRQ EMNATSSQDEFAKWAKLRRQHDKLYDQLEKSKSSLDSTKSTFDTSVSTLRWLGTNGLRML LQFWFSKQAMFWLPKGWFPYYAEWLLSFPRAPLGSISIQAWTLACAAVILLVSDALVAVV ALVLGARTGVQGQKAKKMEEPMKAGGQGTEKAGKKEL
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the significance of studying transcription factors in Sclerotinia sclerotiorum?

Transcription factors (TFs) play crucial roles in regulating the growth, development, and response to abiotic stress of necrotrophic phytopathogens like S. sclerotiorum. These regulatory proteins control the expression of numerous genes involved in various cellular functions, including pathogenicity, sclerotial development, and stress responses. Understanding the specific TFs and their regulatory networks provides foundational knowledge about how this devastating pathogen functions and adapts to different environments. For example, the Zn2Cys6 transcription factor SsZNC1 has been found to regulate multiple key cellular processes, including cellulose catabolism, methyltransferase activity, and pathogenicity, making it an important target for functional studies .

What are the main types of transcription factors identified in S. sclerotiorum?

Research has identified several classes of transcription factors in S. sclerotiorum, with zinc finger proteins being particularly important. Two major classes include:

  • Zn2Cys6 binuclear cluster transcription factors (such as SsZNC1) - These contain a GAL4-like Zn2Cys6 DNA-binding domain and are widely distributed among ascomycetes .

  • GATA transcription factors (such as SsNsd1) - These contain zinc finger motifs with conserved cysteine residues that allow binding to GATA-box DNA sequences in promoter regions of target genes .

These transcription factors are highly conserved among related fungal species, suggesting their evolutionary importance in regulating fundamental biological processes.

How does S. sclerotiorum cause disease in plants?

S. sclerotiorum is a broad-host-range fungal pathogen that causes serious agricultural crop diseases. The pathogen employs several key mechanisms:

  • Secretion of cell wall-degrading enzymes, including glycoside hydrolases, cutinases, pectinases, and laccases .

  • Production of effector proteins that interfere with host defense responses.

  • Development of specialized infection structures like compound appressoria.

  • Formation of resilient sclerotia that can survive harsh environmental conditions for several years .

The transcription of virulence-related genes is precisely regulated during infection, with factors like SsZNC1 showing increased expression levels during early stages of host colonization .

What are the recommended methods for targeted gene deletion in S. sclerotiorum?

For targeted gene deletion in S. sclerotiorum, homologous recombination technology and the split-marker method have proven effective. The process involves:

  • Design and construction of knockout vectors containing selectable markers flanked by sequences homologous to the target gene.

  • Transformation of the fungus using appropriate protocols.

  • Selection of transformants on media containing selective agents.

  • Isolation of homozygous knockout mutants through ascospore isolation.

  • Verification of gene deletion through PCR analysis, confirming:

    • Absence of the target gene sequence in knockout mutants

    • Presence of flanking sequences

    • Absence of transcript using RT-PCR

For complementation studies, the complete gene fragment with its own promoter (and potentially tags like 3×FLAG) should be reintroduced into the knockout mutant's genome to verify that observed phenotypes are attributable to the deletion of the target gene .

How can researchers effectively analyze protein-protein interactions in S. sclerotiorum?

Several approaches have proven effective for studying protein-protein interactions in S. sclerotiorum:

  • Yeast two-hybrid (Y2H) system: Useful for initial identification of potential interacting partners.

  • Co-immunoprecipitation (Co-IP): For confirming interactions in vivo, particularly when combined with protein tagging (e.g., FLAG tags).

  • Bimolecular Fluorescence Complementation (BiFC): Allows visualization of protein interactions in living cells.

  • Site-directed mutagenesis: To identify specific residues involved in interactions, such as the conserved cysteine residues that form disulfide bonds between SsNsd1 and SsFdh1 .

  • Subcellular localization studies: To determine where protein interactions occur, such as the nuclear translocation observed with the SsNsd1-SsFdh1 interaction .

When studying zinc finger protein interactions, particular attention should be paid to conserved cysteine residues, as they can form disulfide bonds critical for protein-protein interactions, as demonstrated with SsNsd1 and SsFdh1 .

What techniques are recommended for analyzing transcriptional regulation by fungal transcription factors?

To analyze transcriptional regulation by fungal transcription factors like those in S. sclerotiorum, researchers should consider:

  • RNA-Seq and transcriptomic analysis: To identify differentially expressed genes (DEGs) between wild-type and transcription factor mutant strains.

  • RT-qPCR validation: To confirm expression patterns of selected genes identified in transcriptomic analyses.

  • Promoter analysis: Identification of binding motifs (e.g., GATA-box sequences) in the promoter regions of regulated genes.

  • Chromatin immunoprecipitation (ChIP): To verify direct binding of transcription factors to target gene promoters in vivo.

  • Electrophoretic mobility shift assay (EMSA): To confirm the binding capacity of transcription factors to specific DNA sequences in vitro.

  • Reporter gene assays: To analyze promoter activity in response to transcription factor binding .

For example, SsNsd1 was found to directly bind to GATA-box DNA in the promoter region of Ssfdh1, and the SsNsd1-SsFdh1 interaction was shown to prevent efficient binding of SsNsd1 to GATA-box DNA .

How do transcription factors coordinate sclerotial development in S. sclerotiorum?

Sclerotial development in S. sclerotiorum is a complex process regulated by multiple transcription factors that coordinate the expression of genes involved in morphogenesis and cellular differentiation. Research has shown that:

  • The Zn2Cys6 transcription factor SsZNC1 influences both the number and size of sclerotia. Knockout mutants (ΔSsZNC1) produce smaller but more numerous sclerotia compared to wild-type strains, with an approximately 15% increase in number but 30% decrease in weight .

  • The GATA transcription factor SsNsd1 and its interacting partner SsFdh1 show synchronized expression patterns during different developmental stages, with higher expression in hyphal stages compared to sclerotium stages (S1-S5) .

  • The regulatory relationship between SsNsd1 and SsFdh1 is critical, as SsNsd1 directly regulates Ssfdh1 transcription by binding to GATA-box elements in its promoter region .

The complex transcriptional networks governing sclerotial development involve both positive and negative regulators, creating a balanced system that responds to environmental cues and developmental timing.

What is the relationship between stress responses and virulence in S. sclerotiorum?

Research indicates a significant overlap between stress response mechanisms and virulence in S. sclerotiorum:

  • Transcription factors like SsZNC1 have dual roles in both stress tolerance and pathogenicity. ΔSsZNC1 mutants exhibit both reduced virulence and increased sensitivity to hyperosmotic stress (particularly to high concentrations of sorbitol) .

  • The formaldehyde dehydrogenase SsFdh1, which interacts with the GATA transcription factor SsNsd1, functions in both formaldehyde detoxification and pathogenicity .

  • Stress-responsive genes are often co-regulated with virulence-associated genes, suggesting shared regulatory pathways .

This relationship likely reflects the environmental challenges faced by the pathogen during infection, where it must cope with host defense responses, including oxidative stress and osmotic changes. Transcription factors serve as master regulators that coordinate these responses, allowing the fungus to adapt to changing conditions while maintaining its pathogenic capabilities.

How do protein modifications and interactions affect transcription factor function in S. sclerotiorum?

Protein modifications and interactions significantly impact transcription factor function in S. sclerotiorum through several mechanisms:

  • Redox-based regulation: Conserved cysteine residues in zinc finger motifs can form disulfide bonds, as observed between SsNsd1 and SsFdh1. Site-directed point mutations of these cysteine residues influence protein-protein interactions and DNA binding capacity .

  • Nuclear localization: The SsNsd1-SsFdh1 interaction affects nuclear translocation, which in turn influences transcriptional activity. This interaction was found to prevent efficient binding of SsNsd1 to GATA-box DNA .

  • Protein complex formation: Transcription factors may function as part of larger protein complexes that modulate their activity. For example, SsFdh1 is not only regulated by SsNsd1 but also functionally cooperates with it .

These regulatory mechanisms create complex feedback loops and allow for fine-tuned control of gene expression in response to different environmental conditions and developmental stages.

How should researchers interpret phenotypic differences between wild-type and transcription factor mutants?

When interpreting phenotypic differences between wild-type and transcription factor mutants in S. sclerotiorum, researchers should consider:

  • Multiple phenotypic parameters: Assess growth rate, colony morphology, sclerotial development, stress responses, and virulence to obtain a comprehensive picture of the mutant phenotype.

  • Complementation studies: Always include complemented strains to confirm that observed phenotypes are due to the targeted gene deletion rather than off-target effects.

  • Quantitative assessment: Use statistical analysis to determine significance of phenotypic differences. For example, when analyzing sclerotial development in SsZNC1 mutants, both number and weight of sclerotia were quantified, revealing a 15% increase in number but 30% decrease in weight .

  • Stress-specific responses: Test multiple stress conditions, as transcription factor mutants may show specific defects. For instance, ΔSsZNC1 mutants showed increased sensitivity to sorbitol but not to NaCl, SDS, or Congo red .

  • Temporal dynamics: Consider time-dependent changes in phenotypes, especially for developmental processes like sclerotial formation.

The table below illustrates how phenotypic parameters were quantified for SsZNC1 mutants compared to wild-type:

Phenotypic ParameterWild-TypeΔSsZNC1 MutantsSignificance
Growth rate on PDANormalNo significant differenceNot significant
Colony morphologyNormalNo significant differenceNot significant
Sclerotia numberBaseline~15% increaseSignificant
Sclerotia weightBaseline~30% decreaseSignificant
Osmotic stress (sorbitol) inhibition14%23%Significant
Other stresses (NaCl, SDS, Congo red)BaselineNo significant differenceNot significant
Virulence on host plantsBaselineSignificantly reducedSignificant

What approaches are most effective for analyzing transcriptomic data from S. sclerotiorum studies?

For effective analysis of transcriptomic data from S. sclerotiorum studies, researchers should:

  • Perform differential expression analysis: Compare gene expression profiles between wild-type and mutant strains to identify differentially expressed genes (DEGs).

  • Conduct functional enrichment analysis: Categorize DEGs using Gene Ontology (GO) terms and KEGG pathways to identify biological processes affected by the transcription factor.

  • Focus on secreted proteins: Prioritize analysis of genes encoding secreted proteins with signal peptides, as they often play crucial roles in pathogenesis. The top differentially expressed secreted proteins should be identified and characterized.

  • Validate with RT-qPCR: Confirm expression patterns of selected genes using RT-qPCR, particularly for:

    • Genes related to pathogenicity (e.g., cell wall-degrading enzymes)

    • Known effector genes

    • Genes involved in specific cellular processes of interest

  • Analyze temporal expression patterns: Examine gene expression at different time points during infection, sclerotial development, or stress responses.

In the study of SsZNC1, a transcriptomic analysis revealed significant down-regulation of secreted proteins involved in pathogenesis, including glycoside hydrolase family proteins, cutinase, pectinase, and laccase. These findings were validated by RT-qPCR analysis, confirming the role of SsZNC1 in regulating virulence-related genes .

How can researchers determine direct targets of transcription factors in S. sclerotiorum?

To determine direct targets of transcription factors in S. sclerotiorum, researchers should employ multiple complementary approaches:

  • Transcriptomic analysis: Identify genes with altered expression in transcription factor mutants.

  • Promoter sequence analysis: Examine the promoter regions of differentially expressed genes for the presence of known binding motifs. For example, GATA-box sequences for GATA transcription factors like SsNsd1 .

  • Chromatin immunoprecipitation followed by sequencing (ChIP-seq): This technique identifies genome-wide binding sites of the transcription factor in vivo.

  • DNA-binding assays: Electrophoretic mobility shift assays (EMSA) or DNA footprinting can confirm direct binding of the transcription factor to specific DNA sequences.

  • Reporter gene assays: Test the ability of the transcription factor to activate or repress the expression of a reporter gene driven by the promoter of a putative target gene.

The study of SsNsd1 demonstrated that it directly binds to GATA-box DNA in the promoter region of Ssfdh1, confirming a direct regulatory relationship. Furthermore, the interaction with SsFdh1 was found to modulate this DNA binding activity, adding another layer of regulatory complexity .

What are the main challenges in studying transcription factor networks in S. sclerotiorum?

Researchers face several significant challenges when studying transcription factor networks in S. sclerotiorum:

  • Complex regulatory networks: Transcription factors like SsZNC1 and SsNsd1 regulate numerous genes and interact with other proteins, creating intricate regulatory networks that are difficult to fully characterize .

  • Functional redundancy: Multiple transcription factors may have overlapping functions, making it challenging to identify the specific role of individual factors.

  • Temporal and spatial regulation: Expression of transcription factors and their targets varies throughout development and infection, requiring time-course studies for comprehensive understanding.

  • Post-translational modifications: Proteins like SsNsd1 and SsFdh1 contain conserved cysteine residues that form disulfide bonds, affecting their interactions and functions. These modifications add another layer of regulatory complexity .

  • Technical limitations: While significant DEGs can be identified through transcriptomic analysis, determining which genes are directly regulated by specific transcription factors remains challenging. As noted in the SsZNC1 study, "while a significant number of DEGs were discovered in our analysis, the specific genes directly regulated by SsZNC1 remain unknown" .

What novel approaches might advance our understanding of S. sclerotiorum transcription factors?

Several innovative approaches could significantly advance our understanding of S. sclerotiorum transcription factors:

  • CRISPR-Cas9 genome editing: For more precise and efficient gene manipulation, including the creation of point mutations to study specific protein domains or binding sites.

  • Single-cell transcriptomics: To understand cell-type specific expression patterns during complex developmental processes like sclerotial formation.

  • Proteomics approaches: Techniques like proximity-dependent biotin identification (BioID) or tandem affinity purification coupled with mass spectrometry (TAP-MS) to identify all components of transcription factor complexes.

  • In vivo imaging techniques: Live-cell imaging of fluorescently tagged transcription factors to track their dynamics during development and host infection.

  • Structural biology approaches: Crystallography or cryo-electron microscopy to determine the three-dimensional structures of transcription factors and their complexes, providing insights into their functions and interactions.

  • Systems biology integration: Computational models integrating transcriptomic, proteomic, and metabolomic data to better understand the complex regulatory networks controlled by transcription factors like SsZNC1 and SsNsd1.

These approaches could help address current knowledge gaps, such as identifying the direct targets of SsZNC1 and elucidating "the molecular mechanisms underlying its regulatory functions" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.