Recombinant Sclerotinia sclerotiorum Signal peptidase complex catalytic subunit sec11 (sec11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sec11; SS1G_01092; Signal peptidase complex catalytic subunit sec11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
sec11
Target Protein Sequence
MLSFLQNPRQAAAQVLNFALILSTAFMMWKGLSVASDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNLLEETKVGEIVVYNVKGKDIPIVHRLVRKFGAGPKAKLLTKGDNNVADDTELYA RGQDYIEREDIIGSVVGYIPFVGYVTILLSEHPWLKTVMLGMMGLVVVLQRE
Uniprot No.

Target Background

Function
This protein is the catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. Signal peptide cleavage occurs during or after translocation through the translocon pore into the endoplasmic reticulum.
Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of the SEC11 catalytic subunit in Sclerotinia sclerotiorum?

SEC11 functions as the catalytic subunit of the signal peptidase complex (SPC) in S. sclerotiorum, responsible for cleaving signal peptides from nascent proteins destined for secretion or membrane integration. To determine its specific function, researchers should employ a gene disruption approach similar to the method used for SSA gene disruption. This involves amplifying upstream and downstream flanking sequences of the sec11 gene, ligating them to a selectable marker gene (like hygromycin resistance), and transforming S. sclerotiorum protoplasts via polyethylene glycol (PEG)-mediated transformation . Confirmation of disruption can be achieved through PCR, Southern blotting, and RT-PCR to verify the absence of sec11 transcripts. Phenotypic analysis of the disruption mutant would then reveal the functional importance of SEC11 in protein secretion, hyphal growth, and pathogenicity.

What techniques are most effective for expressing recombinant SEC11 from S. sclerotiorum?

For recombinant expression of S. sclerotiorum SEC11, a heterologous expression system in E. coli or P. pastoris is recommended. The methodology should begin with PCR amplification of the complete sec11 open reading frame from S. sclerotiorum genomic DNA, followed by cloning into an appropriate expression vector containing a purification tag (6xHis or GST). For membrane-associated proteins like SEC11, consider using specialized E. coli strains (e.g., C41(DE3) or C43(DE3)) designed for membrane protein expression. Alternatively, P. pastoris offers advantages for eukaryotic posttranslational modifications. Expression conditions (temperature, inducer concentration, and duration) should be optimized through small-scale expression trials before scaling up. Purification protocols should incorporate detergent solubilization steps, as commonly required for membrane-associated proteins like SEC11.

How can I verify the subcellular localization of SEC11 in S. sclerotiorum?

To determine the subcellular localization of SEC11, researchers should consider a complementation approach similar to that used for SSA complementation . Develop a construct containing the native sec11 gene fused to a fluorescent protein tag (GFP or mCherry) under control of its native promoter. Transform this construct into protoplasts of a sec11 disruption mutant using PEG-mediated transformation. Successful transformants should be validated through PCR detection and RT-PCR to confirm expression of the tagged SEC11 . Subcellular localization can then be visualized using confocal microscopy, with co-localization studies employing organelle-specific markers (such as ER-Tracker or KDEL-tagged proteins) to confirm the expected endoplasmic reticulum membrane localization typical of signal peptidase complexes.

What methodology would effectively determine the substrate specificity of S. sclerotiorum SEC11?

Investigating SEC11 substrate specificity requires a comprehensive proteomics approach. Begin by comparing the secretome profiles of wild-type S. sclerotiorum and sec11 disruption mutants using LC-MS/MS analysis. Proteins with accumulated uncleaved signal peptides in the mutant would represent SEC11 substrates. To confirm direct processing by SEC11, develop an in vitro cleavage assay using purified recombinant SEC11 and synthetic peptide substrates based on predicted signal sequences from identified proteins. Cleavage products can be analyzed by MALDI-TOF mass spectrometry to determine precise cleavage sites. Additionally, a complementation experiment with the SEC11 gene should restore normal signal peptide processing, providing further validation of substrate specificity . For highly accurate assessment of cleavage site preferences, construct a library of signal peptide variants through site-directed mutagenesis and test processing efficiency by SEC11 in vitro.

How does SEC11 activity in S. sclerotiorum differ during saprophytic growth versus parasitic infection stages?

To investigate stage-specific SEC11 activity, implement a dual RNA sequencing approach similar to that used to study B. amyloliquefaciens and S. sclerotiorum interactions . Design an experiment comparing sec11 expression levels between S. sclerotiorum grown on artificial media (saprophytic) versus in planta (parasitic) using RT-qPCR and RNA-seq. For in planta studies, inoculate susceptible host plants like canola or soybean as described in previous studies . Harvest tissue samples at different infection stages (early penetration, colonization, and sclerotia formation). Additionally, use a SEC11-promoter fusion with a reporter gene (GFP or luciferase) to visualize expression patterns during different growth stages. For direct measurement of SEC11 activity, develop fluorogenic peptide substrates that produce a signal upon cleavage and apply them to protein extracts from different developmental stages to quantify enzymatic activity.

What are the most efficient protocols for disrupting and complementing the sec11 gene in S. sclerotiorum?

For efficient sec11 gene disruption, follow the split-marker approach used successfully for SSA gene disruption . First, PCR-amplify 1-1.5kb upstream and downstream flanking regions of the sec11 gene using S. sclerotiorum genomic DNA as template. Clone these fragments into a vector containing a hygromycin resistance cassette (hyg). Transform protoplasts prepared from actively growing S. sclerotiorum mycelia using polyethylene glycol (PEG) mediation with 40% PEG 3350, 50 mM CaCl₂, and 10 mM Tris-HCl (pH 7.5). Plate transformed protoplasts on regeneration medium (TB3) containing hygromycin B (50 μg/mL) . Screen transformants using PCR with primers targeting the hygromycin gene and junction regions. Verify disruption through Southern blotting with gene-specific probes and RT-PCR to confirm absence of sec11 transcripts .

For complementation, amplify the full-length sec11 gene with its native promoter and terminator regions from wild-type genomic DNA. Clone this into a vector containing a different selection marker (e.g., neomycin resistance). Transform the disruption mutant protoplasts with this construct using the same PEG-mediated method and plate on regeneration medium with neomycin (50 μg/mL). Confirm complementation through PCR, RT-PCR, and phenotypic restoration studies .

How can researchers accurately assess the impact of SEC11 dysfunction on S. sclerotiorum virulence?

To accurately assess SEC11's impact on virulence, implement a multi-faceted approach combining molecular, biochemical, and pathogenicity assays. Begin with a pathogenicity assay comparing wild-type, sec11 disruption mutant, and complemented strains on susceptible host plants like canola or soybean. Follow established inoculation protocols where mycelial plugs or spore suspensions are applied to wounded plant tissues . Monitor disease progression by measuring lesion size, sclerotia formation, and stem colonization over 7-14 days.

For molecular characterization, perform transcriptome analysis (RNA-seq) comparing gene expression profiles between wild-type and mutant strains during infection. Focus on genes involved in pathogenicity, including cell wall-degrading enzymes, effectors, and oxalic acid metabolism. Complement this with biochemical assays measuring the activity of secreted enzymes (cellulases, pectinases, proteases) in culture filtrates of each strain. Additionally, quantify oxalic acid production using HPLC analysis, as oxalic acid is a major virulence factor of S. sclerotiorum.

Histological examination of infected plant tissues using microscopy techniques will reveal differences in infection structure formation and tissue colonization between strains. Finally, conduct dual-culture assays with potential biocontrol agents like B. amyloliquefaciens to assess whether SEC11 disruption affects susceptibility to antagonistic microbes .

What bioinformatic approaches are most valuable for identifying potential SEC11 processing targets in the S. sclerotiorum proteome?

For comprehensive identification of SEC11 processing targets, implement a multi-layered bioinformatic workflow. Begin by extracting the complete proteome of S. sclerotiorum from public databases (NCBI, UniProt). Use signal peptide prediction algorithms (SignalP, PrediSi, and Signal-3L) with eukaryotic parameters to identify proteins containing predicted signal peptides. Apply transmembrane topology prediction tools (TMHMM, Phobius) to distinguish between secreted and membrane proteins.

For greater specificity, analyze the characteristics of known SEC11 substrates to develop a position-specific scoring matrix (PSSM) of preferred cleavage sites. Apply this matrix to predicted signal peptides to score potential SEC11 targets. Additionally, perform comparative genomic analysis of signal peptides across related fungal species to identify conserved features that might indicate SEC11 specificity.

Validate high-confidence predictions by integrating proteomics data comparing wild-type and sec11 disruption mutant secretomes, focusing on proteins showing accumulated uncleaved forms in the mutant. Finally, implement structural modeling of SEC11-substrate interactions using homology modeling based on known signal peptidase structures, followed by molecular docking simulations to predict binding affinity and processing efficiency for candidate substrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.