Recombinant Sclerotinia sclerotiorum Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vma21; SS1G_12882; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) (White mold) (Whetzelinia sclerotiorum)
Target Names
vma21
Target Protein Sequence
MATQRRSHNDRIAAGEEKEASFKAEAVLGEKSNIAPAVPAHIIYKLLGFTLAMIIIPISS YFLTLNSIFRGNSTFAGATAAIMANVVLVGYVIVAMKEDQSEALEAAAAKETKTESKKEL
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the predicted function of VMA21 in Sclerotinia sclerotiorum based on orthologous proteins?

    VMA21 is predicted to function as an essential assembly chaperone of the vacuolar ATPase (V-ATPase) complex in S. sclerotiorum, similar to its role in other eukaryotes. In humans and yeast, VMA21 facilitates the assembly of the V0 domain of V-ATPase, which is critical for the proper functioning of this proton pump complex . In S. sclerotiorum, VMA21 likely plays a similar role in maintaining proper pH homeostasis in cellular compartments, which is essential for numerous physiological processes including protein trafficking, enzyme activity, and stress responses.

    The function can be experimentally verified through:

    • Complementation studies using yeast vma21 mutants

    • Subcellular localization studies using fluorescent protein tagging

    • Co-immunoprecipitation with other V-ATPase components

    • Phenotypic characterization of VMA21 knockdown/knockout strains

  • How might VMA21 contribute to S. sclerotiorum virulence mechanisms?

    Based on the known pathogenicity mechanisms of S. sclerotiorum, VMA21 may contribute to virulence through several pathways:

    Potential MechanismFunctional RelevanceExperimental Approach
    pH modulationFacilitates secretion of oxalic acid and cell wall degrading enzymesMeasure extracellular pH in VMA21 mutants
    Protein secretionSupports proper trafficking of virulence factorsQuantify secretome composition in VMA21 mutants
    Stress toleranceEnhances survival under host-induced oxidative stressAssess ROS sensitivity in VMA21 mutants
    Signal transductionMay influence cAMP and MAPK signaling pathwaysMonitor phosphorylation cascades in VMA21 mutants

    S. sclerotiorum's virulence depends on numerous factors including oxalic acid production, cell wall degrading enzymes, and effector proteins . Proper V-ATPase function, facilitated by VMA21, likely supports these virulence mechanisms by maintaining appropriate pH in secretory organelles and facilitating protein trafficking.

  • What genomic and transcriptomic approaches can identify VMA21 expression patterns during infection?

    To characterize VMA21 expression during S. sclerotiorum infection stages:

    • RNA-Seq analysis comparing expression levels across infection timepoints

    • qRT-PCR validation of VMA21 expression during different infection phases

    • Promoter-reporter fusion constructs to visualize expression in planta

    • Single-cell RNA-Seq to identify cell-specific expression patterns during infection

    Analyzing the S. sclerotiorum genome (such as isolate ESR-01 with ~41 Mb assembly size) could reveal regulatory elements controlling VMA21 expression. Expression data should be correlated with other virulence-related genes to establish potential co-regulation networks.

  • How does V-ATPase function relate to pathogenicity in S. sclerotiorum?

    V-ATPase function is likely critical for S. sclerotiorum pathogenicity through:

    1. Maintaining acidic environments required for optimal activity of secreted hydrolytic enzymes

    2. Supporting vesicular trafficking of virulence factors

    3. Facilitating adaptation to changing environmental conditions during infection

    4. Contributing to energy homeostasis during different infection stages

    Experimental evidence from other fungal pathogens shows that disruption of V-ATPase components often results in attenuated virulence. Since S. sclerotiorum employs an infection strategy heavily dependent on secreted enzymes and metabolites , proper V-ATPase function facilitated by VMA21 would be essential for these processes.

  • What bioinformatic tools are most effective for identifying and analyzing VMA21 in the S. sclerotiorum genome?

    For comprehensive VMA21 identification and analysis:

    Analysis TypeRecommended ToolsApplication
    Homology searchBLAST, HMMERIdentify VMA21 candidates based on sequence similarity
    Domain predictionInterProScan, PFAMConfirm presence of characteristic VMA21 domains
    Structural predictionAlphaFold2, I-TASSERModel protein structure
    Transmembrane topologyTMHMM, PhobiusPredict membrane-spanning regions
    Evolutionary analysisMEGA, PhyMLConstruct phylogenetic trees with other fungal VMA21 proteins
    Promoter analysisMEME, JASPARIdentify potential regulatory elements

    The draft genome of S. sclerotiorum isolate ESR-01 (~41 Mb with 328 scaffolds) provides an important resource for these analyses. Comparative genomics with other fungi can reveal conserved and divergent features of VMA21.

Advanced Research Questions

  • What are the optimal expression systems for producing recombinant S. sclerotiorum VMA21 protein?

    Producing functional recombinant VMA21 requires careful consideration of expression systems:

    Expression SystemAdvantagesLimitationsModifications
    E. coliHigh yield, simplicityMembrane protein folding issuesFusion tags, specialized strains
    Yeast (S. cerevisiae)Eukaryotic processing, membrane systemLower yield than bacteriaCodon optimization, inducible promoters
    Insect cellsPost-translational modificationsHigher cost, complexityBaculovirus vectors, controlled temperature
    Plant systemsNative-like environmentTime-consumingTransient expression systems
    Cell-free systemsAvoids toxicity issuesExpensive, limited scaleSupplementation with lipids, chaperones

    For membrane proteins like VMA21, expression in eukaryotic systems often yields better results for structural and functional studies. A dual approach using E. coli for initial screening and yeast/insect cells for larger-scale production of functional protein is recommended.

  • How can gene editing techniques be optimized for studying VMA21 function in S. sclerotiorum?

    To effectively study VMA21 function through gene editing:

    1. CRISPR-Cas9 approach:

      • Design multiple sgRNAs targeting conserved regions of VMA21

      • Use Agrobacterium-mediated transformation for delivery

      • Include selectable markers and screening strategies

      • Verify edits through sequencing and protein expression analysis

    2. RNA interference approach:

      • Design dsRNA or siRNA targeting VMA21 mRNA

      • Establish inducible or constitutive expression systems

      • Quantify knockdown efficiency through qRT-PCR

      • Assess phenotypic changes in growth, development, and virulence

    Host-induced gene silencing (HIGS) targeting S. sclerotiorum genes has shown promise in enhancing host resistance . This approach could be adapted to target VMA21, potentially disrupting the pathogen's ability to maintain pH homeostasis during infection.

  • What methodologies can assess the impact of VMA21 dysfunction on cellular pH regulation in S. sclerotiorum?

    To investigate VMA21's role in pH regulation:

    MethodologyApplicationExpected Outcome
    pH-sensitive fluorescent probesMeasure organelle-specific pHVMA21 mutants may show altered vacuolar/organelle pH
    V-ATPase activity assaysMeasure ATP hydrolysis and proton pumpingReduced activity in VMA21 mutants
    Oxalic acid quantificationMeasure secreted and internal levelsAltered production in VMA21 mutants
    Electron microscopyAssess vacuolar morphologyAbnormal vacuolar structures in mutants
    Lysotracker stainingVisualize acidic compartmentsReduced staining in VMA21-deficient cells

    Based on research in other systems, VMA21 dysfunction raises lysosomal pH, reducing degradative ability and blocking autophagy . In S. sclerotiorum, similar effects could impact virulence-related processes such as nutrient acquisition and stress responses during host colonization.

  • How might VMA21 interact with known virulence mechanisms in S. sclerotiorum?

    VMA21 likely intersects with established virulence mechanisms:

    1. Oxalic acid metabolism: V-ATPase function affects intracellular pH homeostasis, potentially influencing the activity of enzymes like SsOAH1 that regulate oxalic acid production

    2. Cell wall degrading enzymes: Proper pH in secretory vesicles is essential for processing and activity of enzymes like polygalacturonases (SsPG1) and cellulases (SsCBH)

    3. ROS management: VMA21-dependent V-ATPase function may support ROS detoxification systems, similar to SOD1's role in stress tolerance

    4. Effector secretion: The secretome of S. sclerotiorum includes numerous effector proteins that require proper processing and secretion through the endomembrane system

    Experimental approaches should include co-immunoprecipitation, yeast two-hybrid screening, and comparative proteomics of wild-type versus VMA21-deficient strains to identify interacting partners.

  • What are the most effective approaches for targeting VMA21 through host-induced gene silencing (HIGS)?

    HIGS targeting of VMA21 requires careful design:

    Design ElementConsiderationsOptimization Strategy
    Target sequenceSpecificity to pathogen VMA21Select unique regions not conserved in hosts
    Construct designHairpin or antisense orientationTest multiple constructs for efficacy
    Promoter selectionExpression timing and locationUse pathogen-inducible or constitutive promoters
    Delivery methodStable transformation vs. viral vectorsCompare efficiency across methods
    ValidationQuantification of silencing efficiencyMeasure VMA21 transcript levels in the pathogen

    HIGS has been successfully implemented against several S. sclerotiorum genes including SsOAH1, SsCBH, SsPG1, SsGAP1, and SsTrx1 . Similar approaches could be adapted for VMA21, potentially disrupting V-ATPase assembly and reducing pathogen virulence.

  • How does environmental pH affect VMA21 function and V-ATPase assembly in S. sclerotiorum?

    Environmental pH likely influences VMA21 function through:

    1. Regulation of VMA21 expression under different pH conditions

    2. Altered protein stability or conformation affecting chaperone function

    3. Changes in interaction affinity with V-ATPase components

    4. Compensatory mechanisms activated under pH stress

    Experimental approaches should include:

    • Transcriptional analysis of VMA21 under various pH conditions

    • Protein stability assays across pH ranges

    • V-ATPase assembly efficiency assessment under controlled pH

    • Growth and virulence phenotyping of VMA21 mutants across pH gradients

    Since S. sclerotiorum actively modifies its environment through oxalic acid secretion , understanding how environmental pH affects VMA21 function could reveal important feedback mechanisms in pathogenesis.

  • What proteomics approaches can identify the interactome of VMA21 in S. sclerotiorum?

    To characterize the VMA21 interactome:

    ApproachMethodologyExpected Outcomes
    Affinity purification-MSExpress tagged VMA21, purify complexesIdentify direct interacting partners
    BioID or APEX proximity labelingExpress VMA21 fused to biotin ligaseMap spatial proteome around VMA21
    Cross-linking MSChemical cross-linking followed by MSCapture transient interactions
    Comparative proteomicsCompare WT vs. VMA21 mutant proteomesIdentify downstream affected pathways
    PhosphoproteomicsAnalyze phosphorylation changesIdentify signaling impacts of VMA21 dysfunction

    Integration of these data with known virulence factors would help establish how VMA21 contributes to the pathogenicity network in S. sclerotiorum, potentially revealing new therapeutic targets.

  • How can structural biology approaches facilitate the development of inhibitors targeting S. sclerotiorum VMA21?

    Structural biology approaches for VMA21 inhibitor development:

    1. Homology modeling based on solved structures of homologous proteins

    2. Cryo-EM analysis of VMA21 in complex with V-ATPase components

    3. NMR spectroscopy for dynamics and ligand binding studies

    4. Molecular dynamics simulations to identify potential binding pockets

    5. Fragment-based screening to identify initial binding molecules

    6. Structure-activity relationship studies to optimize inhibitor properties

    Selective targeting requires identifying structural differences between fungal and plant/human VMA21. The inhibitor design should focus on disrupting VMA21-V-ATPase interactions rather than direct inhibition of VMA21 itself, as this approach may offer greater specificity.

  • What experimental systems can evaluate the impact of VMA21 mutations on S. sclerotiorum fitness and virulence?

    To comprehensively assess VMA21 mutation effects:

    Experimental SystemMeasurementsRelevance to Pathogenicity
    In vitro growth assaysGrowth rate, colony morphologyBasic fitness parameters
    Stress tolerance testsResponse to oxidative, osmotic stressHost defense evasion capacity
    Sclerotia formation assaysNumber, size, viability of sclerotiaSurvival and persistence
    Detached leaf assaysLesion size, development rateDirect virulence measurement
    Whole plant pathogenicity testsDisease progression, severityField-relevant virulence assessment
    Transcriptomics during infectionGene expression profilesMechanistic insights

    These approaches would provide a comprehensive understanding of how VMA21 contributes to S. sclerotiorum fitness and virulence across different life stages and infection conditions.

  • How do the genomic features of VMA21 in S. sclerotiorum compare to those in other plant pathogenic fungi?

    Comparative genomic analysis of VMA21 across fungal pathogens:

    1. Sequence conservation analysis to identify functionally critical regions

    2. Synteny analysis to examine genomic context conservation

    3. Promoter comparison to identify regulatory differences

    4. Copy number variation assessment across fungal species

    5. Selection pressure analysis (dN/dS ratios) to identify adaptation signatures

    6. Intron-exon structure comparison for evolutionary insights

    The S. sclerotiorum genome (~41 Mb with 328 scaffolds) provides the foundation for these analyses. Comparative studies could reveal lineage-specific adaptations in VMA21 that correlate with differences in host range or virulence strategies among fungal pathogens.

Data Tables

Table 1: Predicted Functional Domains of S. sclerotiorum VMA21 Based on Ortholog Analysis

DomainAmino Acid PositionFunctionConservation Level
ER retention signalC-terminalLocalization to ER membraneHigh
Transmembrane domainsMultipleMembrane integrationHigh
V-ATPase binding regionCentralInteraction with V0 domainModerate
N-glycosylation sitesVariableProtein stability/traffickingLow

Table 2: Potential Effects of VMA21 Dysfunction on S. sclerotiorum Cellular Processes

Cellular ProcessNormal FunctionPredicted Effect of VMA21 DysfunctionEvidence Base
V-ATPase assemblyProper assembly and functionImpaired assembly, reduced proton pumpingDirect, based on VMA21 function in other organisms
Vesicular pH regulationMaintenance of acidic lumenElevated pH in secretory vesicles and vacuolesDirect, based on V-ATPase function
Protein secretionEfficient trafficking of enzymesReduced secretion of virulence factorsIndirect, based on endomembrane system function
AutophagyNormal cellular recyclingBlocked autophagy, possible vacuolationDirect, based on VMA21 studies in other systems
Stress responsesEffective management of host defensesIncreased sensitivity to oxidative stressIndirect, based on V-ATPase roles in stress tolerance

Table 3: Methodological Approaches for VMA21 Functional Characterization in S. sclerotiorum

ApproachTechniqueApplicationTechnical Considerations
Gene manipulationCRISPR-Cas9Gene knockout/modificationOptimize transformation for S. sclerotiorum
Expression analysisRT-qPCRQuantify expression levelsDesign primers specific to VMA21
Protein localizationFluorescent protein fusionDetermine subcellular locationMaintain protein functionality
Protein-protein interactionCo-immunoprecipitationIdentify interacting partnersDevelop specific antibodies
Functional complementationHeterologous expressionVerify functionUse yeast vma21 mutants
Structural analysisCryo-EMDetermine protein structureOvercome membrane protein challenges
Phenotypic analysisPathogenicity assaysAssess virulence impactUse multiple host plants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.