Recombinant Scotinomys teguina NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

What is the function of MT-ND3 in the mitochondrial respiratory chain?

MT-ND3 functions as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) and is believed to belong to the minimal assembly required for catalysis. The protein plays a crucial role in the transfer of electrons from NADH to the respiratory chain, with ubiquinone serving as the immediate electron acceptor for the enzyme . In mammalian species like Scotinomys teguina, this process is essential for cellular energy production.

The protein's involvement in electron transfer makes it critical for maintaining proper mitochondrial function. Research approaches to study this function typically include spectrophotometric assays measuring NADH oxidation rates, polarographic oxygen consumption measurements, and fluorescence-based methods that detect changes in mitochondrial membrane potential. When studying Scotinomys teguina MT-ND3, researchers should consider comparative analyses with closely related rodent species such as Baiomys taylori to identify conserved functional domains.

What are common methods for expressing recombinant MT-ND3 in laboratory settings?

Expression of recombinant MT-ND3 is commonly achieved using prokaryotic expression systems, particularly E. coli. Based on protocols established for related proteins, the following methodology is recommended:

• Gene synthesis or PCR amplification of the MT-ND3 coding sequence from Scotinomys teguina mitochondrial DNA

• Cloning into an appropriate expression vector (typically containing a His-tag for purification)

• Transformation into an E. coli expression strain

• Induction of protein expression using IPTG or similar inducers

• Cell lysis and protein extraction

• Purification using affinity chromatography (typically Ni-NTA for His-tagged proteins)

• Quality control via SDS-PAGE and Western blotting

For example, recombinant full-length Baiomys taylori MT-ND3 protein (1-115aa) has been successfully expressed in E. coli with an N-terminal His-tag . Similar approaches would likely be effective for Scotinomys teguina MT-ND3, with appropriate optimization of expression conditions based on codon usage and protein solubility.

How should recombinant MT-ND3 be stored and reconstituted for experimental use?

For optimal stability and activity of recombinant Scotinomys teguina MT-ND3, follow these methodological guidelines based on established protocols for similar proteins:

Storage protocol:

• Store the lyophilized powder at -20°C/-80°C upon receipt

• After reconstitution, add glycerol to a final concentration of 50%

• Aliquot to minimize freeze-thaw cycles

• Store working aliquots at 4°C for up to one week

• Store long-term aliquots at -20°C/-80°C

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to 5-50% final concentration depending on experimental requirements

• Avoid repeated freeze-thaw cycles as this may lead to protein denaturation and loss of activity

When designing experiments, it's important to validate protein activity after reconstitution using appropriate enzymatic assays specific to NADH-ubiquinone oxidoreductase function.

What techniques are available for detecting MT-ND3 in tissue samples?

Several techniques are available for detecting MT-ND3 in Scotinomys teguina tissue samples:

• Immunohistochemistry (IHC):

  • Useful for localizing MT-ND3 within tissue sections

  • Requires specific antibodies that recognize Scotinomys teguina MT-ND3 or cross-reactive antibodies

  • Commercial antibodies for human MT-ND3 could potentially cross-react with rodent proteins

• Western Blotting:

  • Allows for semi-quantitative analysis of protein expression

  • Provides information about protein size and potential post-translational modifications

  • Can be coupled with subcellular fractionation to confirm mitochondrial localization

• PCR and Sequencing:

  • For detection and characterization of the MT-ND3 gene

  • PCR primers can be designed based on conserved regions among rodent species

  • Example primer pair (adaptable from other studies): Forward 5′-CCACAACTCAACGGCTACAT-3′, Reverse 5′-TGGGTGTTGAGGGTTATGAG-3′

• ELISA:

  • Enables quantitative measurement of MT-ND3 in tissue lysates

  • Several commercially available antibodies have validated ELISA applications

When selecting an appropriate detection method, consider the specific research question, required sensitivity, and available reagents with potential cross-reactivity to Scotinomys teguina proteins.

What are the critical considerations in designing experiments to study MT-ND3 mutations in Scotinomys teguina?

When designing experiments to study MT-ND3 mutations in Scotinomys teguina, researchers should consider these methodological approaches:

• Mutation identification strategy:

  • Whole mitochondrial genome sequencing to identify naturally occurring variants

  • PCR amplification and Sanger sequencing targeting the MT-ND3 gene region

  • Analysis of sequence data against reference sequences from closely related species

• Mutation classification framework:

  • Distinguish between synonymous and non-synonymous mutations

  • Predict potential functional impacts using in silico tools

  • Compare with known pathogenic mutations in human and other model organisms

• Functional assessment methodology:

  • Measure Complex I activity using spectrophotometric assays

  • Assess ROS production levels (mutations may increase ROS as observed in rs2853826 polymorphism)

  • Evaluate mitochondrial membrane potential using fluorescent probes

  • Measure oxygen consumption rates in isolated mitochondria or cell models

• Experimental controls:

  • Include wild-type MT-ND3 as positive control

  • Use known non-functional mutants as negative controls

  • Include closely related species (e.g., Baiomys taylori) for evolutionary comparisons

• Expression system selection:

  • Consider both homologous and heterologous expression systems

  • E. coli expression for protein structure studies

  • Mammalian cell lines for functional studies of mutations

Researchers should be particularly attentive to the potential impact of mutations on electron transfer efficiency, protein stability, and interaction with other Complex I subunits.

How do polymorphisms in MT-ND3 potentially affect mitochondrial function in rodent species?

Polymorphisms in MT-ND3 can significantly impact mitochondrial function in rodent species through multiple mechanisms:

• Altered electron transfer efficiency:

  • SNPs in coding regions may affect critical residues involved in electron transfer

  • This can lead to decreased Complex I activity and ATP production

  • For example, the rs2853826 polymorphism increases ROS production in humans with implications for metabolic disorders

• Protein stability and complex assembly:

  • Mutations may affect protein folding and stability

  • This can impair proper assembly of Complex I

  • Destabilized protein structure may lead to accelerated degradation

• Species-specific effects:

  • Polymorphisms that are neutral in one species may be pathogenic in another

  • Evolutionary adaptation may lead to compensatory mutations in other mitochondrial genes

• Physiological consequences:

  • MT-ND3 polymorphisms have been associated with various human diseases including gastric cancer, Parkinson's disease, and type 2 diabetes

  • In rodents, similar associations might exist with species-specific diseases or traits

When studying Scotinomys teguina MT-ND3 polymorphisms, researchers should consider both naturally occurring variants and experimentally induced mutations to comprehensively understand functional implications.

What challenges exist in comparing MT-ND3 function across different rodent species?

Comparing MT-ND3 function across different rodent species presents several methodological challenges:

• Sequence variation and structural differences:

  • Even closely related species may have significant amino acid differences

  • The MT-ND3 protein from Baiomys taylori (Northern pygmy mouse) consists of 115 amino acids , but sequence variation exists across rodent species

  • These differences may affect protein folding, stability, and interaction with other Complex I subunits

• Experimental standardization issues:

  • Different tissue sources and mitochondrial isolation protocols can introduce variability

  • Species-specific optimal conditions for enzyme activity assays

  • Antibody cross-reactivity problems requiring validation for each species

• Functional context variation:

  • Metabolic rates differ substantially between rodent species

  • Environmental adaptations may result in different optimal functioning parameters

  • Scotinomys teguina's high-altitude habitat may have selected for specific MT-ND3 adaptations

• Technical approach selection:

  • Direct biochemical comparison requires purified mitochondria from each species

  • Recombinant protein studies may not fully recapitulate in vivo function

  • Heterologous expression systems may introduce confounding factors

• Data interpretation complexities:

  • Distinguishing species-specific adaptations from pathogenic variations

  • Accounting for compensatory mutations in other mitochondrial genes

  • Correlating biochemical differences with physiological adaptations

To address these challenges, researchers should employ multiple complementary approaches, including:

• Comparative sequence analysis with phylogenetic context

• Standardized biochemical assays with appropriate controls

• Heterologous expression in neutral cellular backgrounds

• Structural modeling based on cryo-EM data from related proteins

How can cryo-EM be optimized for studying the structure of MT-ND3 in Complex I?

Optimizing cryo-EM for studying the structure of MT-ND3 in Scotinomys teguina Complex I requires several methodological considerations:

• Sample preparation optimization:

  • Isolation of intact mitochondria from fresh Scotinomys teguina tissue

  • Gentle solubilization of the mitochondrial membrane using appropriate detergents

  • Purification of Complex I while maintaining native interactions

  • Verification of complex integrity through activity assays and SDS-PAGE

• Grid preparation parameters:

  • Testing multiple grid types (Quantifoil, C-flat)

  • Optimizing blotting conditions to achieve thin ice

  • Implementing graphene oxide or thin carbon support films to improve particle orientation distribution

  • Using automated vitrification systems to ensure reproducibility

• Data collection strategy:

  • High-end electron microscopes (300kV Titan Krios or equivalent)

  • Direct electron detectors with high DQE (detective quantum efficiency)

  • Motion correction software to account for beam-induced movement

  • Dose fractionation to minimize radiation damage

• Data processing workflow:

  • Implement reference-free 2D classification to select homogeneous particles

  • Use 3D classification to separate conformational states

  • Apply focused refinement approaches to enhance resolution of MT-ND3 region

  • Consider symmetry-expanded particle stacks if applicable

• Model building and validation:

  • Start with homology models based on related structures

  • Refine models against the cryo-EM density

  • Validate using MolProbity or similar tools

  • Confirm functional aspects through mutagenesis studies

Studies have shown that structural flexibility in certain regions of the complex can present challenges for achieving high-resolution reconstructions. For example, in the Na+-NQR complex, some regions showed weak density attributed to structural flexibility rather than subunit loss . Similar challenges might be expected for Scotinomys teguina Complex I, particularly in the MT-ND3 region.

What is the current understanding of MT-ND3's role in ROS production and how might this differ in singing mice species?

Current understanding of MT-ND3's role in ROS production comes primarily from human and model organism studies, with potential implications for singing mice species like Scotinomys teguina:

• Structural basis for ROS production:

  • MT-ND3 forms part of the ubiquinone binding site in Complex I

  • Alterations in this region can affect electron transfer efficiency

  • Inefficient electron transfer can lead to increased electron leakage and ROS formation

• Polymorphism-associated ROS modulation:

  • The human polymorphism rs2853826 in MT-ND3 has been shown to increase ROS production in type 2 diabetes mellitus patients

  • Similar polymorphisms may exist in Scotinomys teguina with potential functional consequences

• Physiological implications specific to singing mice:

  • Singing behavior in Scotinomys teguina requires high energy expenditure

  • This may create selective pressure for optimal mitochondrial function

  • Species-specific adaptations in MT-ND3 might modulate ROS production during high-energy activities

• Methodological approaches to study ROS in relation to MT-ND3:

  • Fluorescent dye-based assays (DCF-DA, MitoSOX) to quantify ROS production

  • Genetic modification approaches to introduce specific MT-ND3 variants

  • Comparison of ROS levels between vocalizing and non-vocalizing states

  • Measurement of antioxidant enzyme activities in tissues with high MT-ND3 expression

Understanding MT-ND3's role in ROS production in Scotinomys teguina could provide insights into metabolic adaptations for high-energy behaviors like singing and potential trade-offs between performance and oxidative stress.

What are the best approaches for generating antibodies specific to Scotinomys teguina MT-ND3?

Generating specific antibodies against Scotinomys teguina MT-ND3 requires careful consideration of several methodological approaches:

• Antigen design strategy:

  • Whole protein approach: Express and purify full-length recombinant MT-ND3 protein from Scotinomys teguina

  • Peptide approach: Identify unique, antigenic regions specific to Scotinomys teguina MT-ND3

  • Compare amino acid sequences with closely related species to identify divergent regions

  • Prioritize regions predicted to be exposed in the native protein

• Antibody production methodology:

  • Polyclonal antibodies: Immunize rabbits or other suitable host species with the purified recombinant protein or conjugated peptides

  • Monoclonal antibodies: Develop hybridomas after immunizing mice with the target antigen

  • Recombinant antibodies: Screen phage display libraries against purified MT-ND3

• Validation protocols:

  • Western blotting against recombinant protein and native mitochondrial extracts

  • Immunoprecipitation followed by mass spectrometry confirmation

  • Immunohistochemistry with appropriate positive and negative controls

  • Preabsorption tests with immunizing antigen to confirm specificity

  • Cross-reactivity testing against MT-ND3 from other rodent species

• Application optimization:

  • Determine optimal antibody dilution for each application (ELISA, IHC, Western blotting)

  • Optimize blocking conditions to minimize background

  • Establish appropriate fixation conditions for IHC applications

Commercial antibodies against human MT-ND3 are available for ELISA and IHC applications , but these should be validated for cross-reactivity with Scotinomys teguina MT-ND3 before use. Researchers may need to develop custom antibodies if cross-reactivity is insufficient or if highly specific detection is required.

How can researchers effectively study MT-ND3 polymorphisms in wild Scotinomys teguina populations?

Studying MT-ND3 polymorphisms in wild Scotinomys teguina populations requires a comprehensive methodological framework:

• Sampling strategy design:

  • Establish geographic sampling range covering the species' distribution

  • Calculate appropriate sample sizes for statistical power

  • Consider elevation gradients, habitat types, and potential population structures

  • Collect non-invasive samples (buccal swabs) or tissue samples (ear punches) with proper permits

• DNA extraction and quality control:

  • Optimize extraction protocols for field-collected samples

  • Assess DNA quality using spectrophotometry and gel electrophoresis

  • Implement controls to detect potential contamination

• MT-ND3 amplification and sequencing:

  • Design PCR primers based on conserved regions of related species

  • Optimize PCR conditions for specificity and yield

  • Employ both direct Sanger sequencing and next-generation sequencing approaches

  • Example primer design could be adapted from established protocols: Forward 5′-CCACAACTCAACGGCTACAT-3′, Reverse 5′-TGGGTGTTGAGGGTTATGAG-3′

• Polymorphism analysis methodology:

  • Align sequences to a reference Scotinomys teguina MT-ND3 sequence

  • Identify single nucleotide polymorphisms (SNPs) and structural variants

  • Calculate population genetics parameters (heterozygosity, FST, etc.)

  • Test for signatures of selection or recent demographic changes

• Functional assessment of identified variants:

  • Express recombinant variants in appropriate systems

  • Measure enzyme activity and electron transfer efficiency

  • Assess ROS production in cells expressing different variants

  • Correlate genotypes with phenotypic traits (body size, vocalization patterns, etc.)

A similar approach was successfully used to identify five SNPs in human MT-ND3 and their association with gastric cancer risk . Adapting these methods to wild Scotinomys teguina populations would provide valuable insights into the evolutionary forces shaping mitochondrial function in this species.

What techniques are most effective for measuring the enzymatic activity of recombinant MT-ND3 in isolation and within Complex I?

Measuring enzymatic activity of recombinant MT-ND3 requires different methodological approaches depending on whether the protein is studied in isolation or as part of Complex I:

For isolated recombinant MT-ND3:

• Reconstitution into proteoliposomes:

  • Incorporate purified recombinant MT-ND3 into artificial lipid bilayers

  • Measure membrane potential changes using fluorescent dyes

  • Assess protein-lipid interactions using various biophysical techniques

• Binding assays:

  • Evaluate interaction with ubiquinone analogs using isothermal titration calorimetry

  • Measure binding kinetics through surface plasmon resonance

  • Assess structural changes upon ligand binding using circular dichroism

For MT-ND3 within Complex I:

• NADH:ubiquinone oxidoreductase activity:

  • Spectrophotometric assay measuring NADH oxidation at 340 nm

  • Use purified mitochondria or reconstituted Complex I

  • Include appropriate inhibitors to confirm specificity

  • Measure activity in the presence and absence of specific MT-ND3 inhibitors

• Electron transfer rate measurement:

  • Use artificial electron acceptors like ferricyanide

  • Measure site-specific inhibition patterns

  • Assess the impact of specific mutations on electron transfer rates

• Proton pumping efficiency:

  • Reconstitute Complex I into proteoliposomes

  • Monitor pH changes using pH-sensitive dyes

  • Calculate H+/e- ratios to assess coupling efficiency

When validating the activity of recombinant Scotinomys teguina MT-ND3, researchers should confirm that the protein preparation is intact and active, as demonstrated by NADH-UQ oxidoreductase activity that is fully sensitive to specific inhibitors .

How has MT-ND3 evolved in singing mice compared to non-singing rodent species?

The evolution of MT-ND3 in singing mice like Scotinomys teguina compared to non-singing rodent species presents an intriguing research question that can be addressed through several methodological approaches:

• Comparative sequence analysis:

  • Align MT-ND3 sequences from Scotinomys teguina, closely related singing mice, and non-singing rodents

  • Calculate evolutionary rates (dN/dS) to identify regions under positive selection

  • Compare with MT-ND3 from other species with high-energy behaviors

  • Analyze conservation patterns in functional domains

• Structural comparative analysis:

  • Generate homology models based on available structures

  • Compare predicted structural features between singing and non-singing species

  • Identify potential structural adaptations in regions involved in electron transfer

  • Analyze transmembrane domain organization across species

• Functional comparative studies:

  • Express recombinant MT-ND3 from multiple species in standardized systems

  • Compare enzyme kinetics, stability, and response to inhibitors

  • Assess species differences in ROS production under varying conditions

  • Measure thermal stability as an indicator of adaptation to different metabolic rates

• Correlation with physiological parameters:

  • Compare MT-ND3 sequence features with metabolic rates across species

  • Assess relationship between vocalization complexity and MT-ND3 sequence variation

  • Measure mitochondrial density in vocal muscles across species

The amino acid sequence of Baiomys taylori MT-ND3 (MNMIMVISVNIILSSTLILVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQMPDMKTMMLTAFILVSILALGLAYEWTQKGLEWTE) could serve as a useful comparison point for analyzing Scotinomys teguina MT-ND3 adaptations, given their taxonomic relationship.

How do post-translational modifications impact MT-ND3 function, and what methods are best for studying these in Scotinomys teguina?

Post-translational modifications (PTMs) of MT-ND3 play crucial roles in regulating its function, with several methodological approaches available for their study in Scotinomys teguina:

• Identification of potential PTMs:

  • Mass spectrometry-based proteomics of purified mitochondria

  • Enrichment strategies for specific modifications (phosphorylation, acetylation, etc.)

  • Site-specific antibodies against known PTMs

  • Prediction of potential modification sites using computational tools

• Functional significance assessment:

  • Site-directed mutagenesis to mimic or prevent specific modifications

  • Activity assays comparing wild-type and mutant proteins

  • Time-course studies to correlate modifications with functional changes

  • In vivo studies correlating PTM status with physiological states

• Regulatory mechanisms investigation:

  • Identification of enzymes responsible for adding/removing PTMs

  • Studies of signaling pathways that trigger MT-ND3 modifications

  • Analysis of tissue-specific and condition-specific modification patterns

  • Comparative studies across related species

When studying PTMs in Scotinomys teguina MT-ND3, it's important to consider species-specific modification patterns that may reflect adaptations to their unique ecological niche and high-energy vocalizations. Tissue-specific analyses focusing on vocal muscle mitochondria compared to other tissues would be particularly informative.

What experimental design is optimal for studying the effects of MT-ND3 variants on ROS production in Scotinomys teguina cells?

An optimal experimental design for studying the effects of MT-ND3 variants on ROS production in Scotinomys teguina cells requires careful planning and multiple methodological approaches:

• Experimental model selection:

  • Primary fibroblasts or myocytes isolated from Scotinomys teguina

  • Cybrid cell lines containing Scotinomys teguina mitochondria in a neutral nuclear background

  • Heterologous expression systems with introduced MT-ND3 variants

• Variant generation strategy:

  • CRISPR-Cas9 mitochondrial targeting for direct editing (challenging but developing)

  • Cybrid technology to introduce naturally occurring variants

  • Recombinant expression of variant proteins

• ROS measurement methodology:

  • Fluorescent probes: MitoSOX Red (superoxide), DCF-DA (general ROS), Amplex Red (H₂O₂)

  • Live-cell imaging to track real-time ROS production

  • Flow cytometry for quantitative population-level analysis

  • Electron paramagnetic resonance spectroscopy for direct ROS detection

• Experimental conditions matrix:

  • Baseline/unstimulated conditions

  • Substrate availability variations (glucose, fatty acids)

  • Oxygen concentration variations

  • Inhibitor studies (rotenone, antimycin A as positive controls)

  • Stress conditions (hypoxia, metabolic challenge)

• Controls and validation:

  • Wild-type MT-ND3 as negative control

  • Known ROS-inducing mutations as positive controls

  • Antioxidant treatments to confirm ROS specificity

  • Multiple ROS detection methods to avoid assay-specific artifacts

Researchers should focus on the rs2853826 polymorphism region, as this variant has been shown to increase ROS production in humans . The equivalent region in Scotinomys teguina MT-ND3 would be a prime target for generating experimental variants to study their effects on ROS production.

How can researchers effectively compare the structure and function of MT-ND3 across different rodent species?

Effectively comparing the structure and function of MT-ND3 across different rodent species requires an integrated multi-methodological approach:

• Sequence-based comparative analysis:

  • Multiple sequence alignment of MT-ND3 from diverse rodent species

  • Phylogenetic analysis to establish evolutionary relationships

  • Identification of conserved domains and species-specific variations

  • Calculate selection pressures (dN/dS) on different regions of the protein

• Structural comparison methodology:

  • Homology modeling based on available high-resolution structures

  • Analysis of predicted transmembrane topology across species

  • Molecular dynamics simulations to assess structural stability

  • Identification of species-specific structural features

  • Docking studies with ubiquinone and inhibitors

• Functional comparative approach:

  • Expression of recombinant MT-ND3 from multiple species under identical conditions

  • Standard biochemical assays to measure activity parameters

  • Inhibitor sensitivity profiles across species

  • Thermal stability assays as indicators of structural robustness

  • ROS production measurement under standardized conditions

• System for standardization:

  • Use of common expression systems for all species variants

  • Identical purification protocols to avoid method-based variations

  • Consistent assay conditions including temperature, pH, and substrate concentrations

  • Side-by-side testing to minimize inter-experimental variation

• Data integration framework:

  • Correlation of sequence variations with functional differences

  • Mapping functional differences to structural features

  • Statistical analysis to identify significant species-specific characteristics

  • Consideration of ecological and metabolic contexts for each species

This approach would allow researchers to determine how the MT-ND3 protein from Scotinomys teguina differs from related species such as Baiomys taylori (Northern pygmy mouse) , and how these differences might relate to the unique ecological niche and behavioral characteristics of singing mice.

What are the most promising future research directions for understanding MT-ND3 function in Scotinomys teguina?

The most promising future research directions for understanding MT-ND3 function in Scotinomys teguina involve integrating emerging technologies with ecological and evolutionary perspectives:

• Single-cell omics approaches:

  • Single-cell transcriptomics to identify cell-type specific expression patterns

  • Single-mitochondrion functional analysis to assess heterogeneity

  • Spatial transcriptomics to map MT-ND3 expression in vocal muscle tissues

  • Integration of multiple omics data for systems-level understanding

• In vivo real-time imaging and monitoring:

  • Development of mitochondrial function biosensors for live animal imaging

  • Correlation of mitochondrial activity with vocalization behaviors

  • Longitudinal studies of mitochondrial function during development and aging

  • Non-invasive measurement of mitochondrial parameters in wild populations

• Climate change adaptation studies:

  • Investigation of MT-ND3 variants in populations across altitude gradients

  • Thermal adaptation of MT-ND3 function in response to changing environments

  • Experimental evolution studies under controlled environmental conditions

  • Population genetics approaches to detect recent selection

• Comparative bioenergetics in specialized tissues:

  • Focused analysis of vocal muscle mitochondrial function

  • Comparison with non-vocal muscles within the same individual

  • Assessment of tissue-specific optimization of MT-ND3 function

  • Integration with whole-organism metabolic studies

• Therapeutic relevance exploration:

  • Modeling human MT-ND3 disorders using Scotinomys teguina variants

  • Testing potential therapeutic compounds in rodent models

  • Investigation of natural compounds that modulate MT-ND3 function

  • Development of mitochondrial-targeted interventions