Recombinant Scyliorhinus canicula ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

  • Gene Origin: Encoded by the MT-ATP6 mitochondrial gene (UniProt ID: O79406) .

  • Post-Translational Modifications: Fused to an N-terminal His-tag for purification .

Production and Purification

  • Expression System: Produced in Escherichia coli .

  • Purity: >90% as confirmed by SDS-PAGE .

  • Storage: Lyophilized powder stored at -20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0) .

Role in ATP Synthase Complex

  • Mechanism: Facilitates proton translocation across mitochondrial membranes, driving ATP synthesis from ADP .

  • Structural Role: Part of the F₀ subunit of ATP synthase, critical for rotor-stator interactions .

Conservation and Pathogenicity

  • Evolutionary Conservation: Key residues (e.g., proton channel motifs) are conserved across species, including humans .

  • Disease Associations: Mutations in human MT-ATP6 are linked to Leigh syndrome, neuropathy, and ataxia .

Biochemical Studies

  • Enzyme Activity Assays: Used to study ATP hydrolysis and synthesis kinetics .

  • Structural Modeling: Supports cryo-EM and X-ray crystallography studies of ATP synthase .

Disease Modeling

  • Mitochondrial Disorders: Serves as a model to investigate pathogenic variants (e.g., m.8993T>G) affecting ATP synthase function .

Biochemical Features of Recombinant MT-ATP6

PropertySpecification
Host SpeciesScyliorhinus canicula (catshark)
Expression SystemE. coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0
ApplicationsSDS-PAGE, enzyme assays

Pathogenic MT-ATP6 Variants in Humans

VariantBiochemical DefectClinical Phenotype
m.8993T>GReduced ATP synthesis, ROS generationLeigh syndrome, NARP
m.9185T>CImpaired proton pumpingNeurodegenerative ataxia
m.9025G>ADecreased respirationMitochondrial myopathy

Future Directions

  • Therapeutic Research: Allotopic expression of MT-ATP6 in nuclear DNA is being explored for mitochondrial disease therapy .

  • Mechanistic Studies: Elucidating how specific residues (e.g., Tyr-212) regulate proton channel efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
Target Names
Target Protein Sequence
MIMSFFDQFLSPSFLGIPLIALAISIPWLMFPTPTNRWLNNRLLTLQAWFINRFIYQLMQ PMNLGGHKWAILFTALMLFLITINLLGLLPYTFTPTTQLSLNMAFALPLWLTTVLIGMFN QPTIALGHLLPEGTPTPLVPVLIIIETISLFIRPLALGVRLTANLTAGHLLMQLIATAAF VLLTMMPTVALLTSLVLFLLTILEVAVAMIQAYVFVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ATP synthase and where does subunit a fit?

ATP synthase is a multi-subunit molecular machine with a characteristic structure typically represented as α₃:β₃:γ:δ:ε:a:b:b':c₉ . The complex consists of two main domains: the F₁ catalytic domain (containing α, β, γ, δ, and ε subunits) and the membrane-embedded F₀ domain (containing a, b, b', and c subunits).

Subunit a (MT-ATP6) is a critical component of the F₀ domain located in the membrane. It forms a pathway for proton translocation and interacts directly with the c-ring, facilitating the rotary mechanism that couples proton flow to ATP synthesis. In the F-ATP synthase complex, specific interactions between subunit a and other components, particularly the rotary γ subunit, are crucial for regulating both ATP synthesis and hydrolysis functions .

What are the optimal storage conditions for recombinant MT-ATP6 protein?

For optimal stability and functionality of recombinant Scyliorhinus canicula MT-ATP6 protein, the following storage conditions are recommended:

ParameterRecommended ConditionNotes
Primary storage-20°C/-80°CAliquoting is necessary for multiple use
Working aliquots4°CFor up to one week
Buffer compositionTris/PBS-based buffer, pH 8.0With 6% Trehalose
Glycerol content50% (final concentration)For long-term storage
Physical formLyophilized powder or solutionReconstitute lyophilized powder in deionized sterile water
Concentration0.1-1.0 mg/mLAfter reconstitution

Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . For extended storage periods, keeping the protein at -80°C is preferable to maximize stability.

How can researchers verify the functionality of recombinant MT-ATP6 in experimental settings?

Verifying the functionality of recombinant MT-ATP6 requires demonstration of its integration into the ATP synthase complex and contribution to ATP synthesis/hydrolysis activities. Several complementary approaches can be employed:

  • ATP Synthesis Assays: Use purified recombinant MT-ATP6 to reconstitute with other ATP synthase subunits in liposomes or inverted membrane vesicles. Measure ATP production upon establishing a proton gradient across the membrane using methods like luciferase-based luminescence assays .

  • Interaction Studies: Perform co-immunoprecipitation or pull-down assays to verify that recombinant MT-ATP6 interacts correctly with other subunits, particularly the c-ring and subunit γ, which are critical for function.

  • Inhibition Studies: Test whether the reconstituted complex containing recombinant MT-ATP6 responds appropriately to known ATP synthase inhibitors (e.g., oligomycin).

  • Complementation Assays: Express the recombinant protein in cells lacking functional MT-ATP6 to assess whether it restores ATP synthase activity.

  • Structural Analysis: Use techniques like circular dichroism to verify proper folding or cryo-EM to visualize integration into the ATP synthase complex.

Key controls should include parallel experiments with known functional and non-functional (e.g., mutated) versions of MT-ATP6 to establish benchmarks for normal activity .

What techniques can be used to study the interaction between MT-ATP6 and other subunits of ATP synthase?

Understanding the interactions between MT-ATP6 and other ATP synthase subunits is critical for elucidating regulatory mechanisms. Several methodologies are available:

  • Cryo-Electron Microscopy: Provides high-resolution structural information about the entire ATP synthase complex, revealing interaction interfaces between subunit a and other components.

  • Cross-linking Mass Spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify amino acids in close proximity at subunit interfaces.

  • FRET (Förster Resonance Energy Transfer): By tagging MT-ATP6 and potential interaction partners with appropriate fluorophores, researchers can detect and quantify real-time interactions in reconstituted systems.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique maps protein-protein interaction surfaces by identifying regions protected from solvent exchange upon complex formation.

  • Site-Directed Mutagenesis: Systematic mutation of residues at predicted interaction surfaces can identify critical amino acids for functional interactions.

  • Computational Molecular Dynamics: Simulations can predict interaction modes between MT-ATP6 and other subunits, particularly the rotary subunit γ, generating hypotheses that can be tested experimentally .

Research has shown that the C-terminal region of ATP synthase α subunit interacts with the γ subunit in a manner that regulates rotary coupling and enzyme activity. Similar interaction studies with MT-ATP6 could reveal species-specific regulatory mechanisms .

How can researchers design inhibition assays for ATP synthase using recombinant MT-ATP6?

Developing inhibition assays for ATP synthase using recombinant MT-ATP6 provides valuable tools for screening potential inhibitors and understanding regulatory mechanisms. A systematic approach includes:

  • Reconstitution of Functional Complex: Incorporate recombinant MT-ATP6 into proteoliposomes or inverted membrane vesicles along with other ATP synthase subunits to create a functional enzyme complex.

  • ATP Synthesis Measurement Protocol:

    • Establish a proton gradient across the membrane

    • Add ADP and Pi as substrates

    • Measure ATP production using luciferase-based assays or HPLC

    • Calculate initial reaction rates

  • Inhibitor Testing Workflow:

    • Pre-incubate the reconstituted complex with test compounds

    • Initiate ATP synthesis reaction

    • Compare activity to uninhibited controls

    • Generate dose-response curves for positive hits

  • Data Analysis Parameters:

    • Calculate IC₅₀ values for effective inhibitors

    • Determine inhibition kinetics (competitive, non-competitive, uncompetitive)

    • Assess specificity using control enzymes

  • Structure-Activity Relationship Studies: For identified inhibitors, modify chemical structures systematically and correlate with inhibitory potency to identify critical pharmacophore features.

This approach has been successfully employed with mycobacterial F-ATP synthase, where compounds targeting the interaction between the α C-terminus and subunit γ have shown inhibitory activity in the micromolar range .

What are the challenges in expressing functional MT-ATP6 in heterologous systems?

Expressing functional MT-ATP6 in heterologous systems presents several challenges that researchers must address:

  • Membrane Protein Expression Barriers:

    • MT-ATP6 is a hydrophobic membrane protein with multiple transmembrane helices

    • Proper insertion into membranes requires specialized translation machinery

    • Overexpression often leads to toxicity or inclusion body formation

  • Post-translational Modifications:

    • E. coli lacks machinery for eukaryotic post-translational modifications

    • Potential absence of critical modifications may affect function

    • Alternative expression systems (insect cells, yeast) may better preserve native modifications

  • Folding and Stability Issues:

    • Correct folding may require specific chaperones absent in heterologous hosts

    • Detergent selection for extraction is critical for maintaining native structure

    • Lipid environment affects stability and functionality

  • Assembly with Partner Subunits:

    • MT-ATP6 functions as part of a multi-subunit complex

    • Expressing single subunits may yield non-physiological conformations

    • Co-expression with partner subunits may be necessary for proper folding

  • Functional Assessment Complexities:

    • Activity assays require reconstitution with other ATP synthase subunits

    • Establishing appropriate proton gradients in artificial systems is technically challenging

    • Discriminating between proper folding issues and inherent functional characteristics

Strategies to overcome these challenges include using specialized E. coli strains designed for membrane protein expression, fusion with solubility-enhancing tags that can be later removed, and optimization of induction conditions to balance yield with proper folding .

What is the recommended protocol for reconstituting lyophilized MT-ATP6 protein?

For optimal reconstitution of lyophilized Recombinant Scyliorhinus canicula MT-ATP6 protein, the following step-by-step protocol is recommended:

  • Pre-reconstitution Preparation:

    • Centrifuge the vial briefly (30 seconds at 10,000 × g) to collect powder at the bottom

    • Allow the sealed vial to reach room temperature before opening

    • Prepare sterile deionized water or appropriate buffer

  • Reconstitution Procedure:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Gently mix by rotating the vial until complete dissolution

    • Avoid vigorous shaking or vortexing to prevent protein denaturation

  • Post-reconstitution Processing:

    • Add glycerol to a final concentration of 50% for storage stability

    • Prepare multiple small-volume aliquots to avoid repeated freeze-thaw cycles

    • Label aliquots with concentration, date, and protein information

  • Quality Control Checks:

    • Verify protein concentration using Bradford or BCA assay

    • Assess purity by SDS-PAGE (should be >90%)

    • If necessary, perform functional assays to confirm activity

  • Storage of Reconstituted Protein:

    • Store working aliquots at 4°C for up to one week

    • Store remaining aliquots at -20°C for routine use

    • For long-term storage, maintain at -80°C

This protocol ensures optimal protein stability while minimizing potential damage from improper handling.

How can researchers use site-directed mutagenesis to investigate critical residues in MT-ATP6?

Site-directed mutagenesis offers a powerful approach to investigate structure-function relationships in MT-ATP6. A systematic research strategy includes:

  • Selection of Target Residues:

    • Use sequence alignment across species to identify conserved residues

    • Focus on charged or polar residues in predicted transmembrane regions

    • Target residues at predicted subunit interfaces (particularly with c-ring)

    • Select residues implicated in proton translocation pathway

  • Mutagenesis Strategy:

    • Design primers for QuikChange or overlap extension PCR methods

    • Create a library of single amino acid substitutions

    • Consider both conservative and non-conservative substitutions

    • Target both alanine scanning and specific functional replacements

  • Expression and Purification of Mutants:

    • Express mutant proteins under identical conditions as wild-type

    • Verify expression levels and solubility

    • Purify using established protocols (His-tag affinity chromatography)

    • Assess protein folding using biophysical methods

  • Functional Characterization:

    • Reconstitute mutants into liposomes with other ATP synthase subunits

    • Measure ATP synthesis/hydrolysis activities

    • Determine proton translocation efficiency

    • Assess complex assembly and stability

  • Data Analysis Framework:

    • Compare activity parameters to wild-type (kcat, Km)

    • Correlate structural position with functional impact

    • Group mutations by phenotypic effect

    • Develop structure-function model

This approach has been successfully applied to mycobacterial ATP synthase studies, revealing that specific residues in the C-terminal region of the α subunit are critical for regulating enzyme activity through interaction with the γ subunit .

What biophysical techniques are most informative for characterizing the structure of recombinant MT-ATP6?

Characterizing the structure of membrane proteins like MT-ATP6 presents unique challenges but several complementary biophysical techniques can provide valuable insights:

  • Circular Dichroism (CD) Spectroscopy:

    • Provides information about secondary structure composition (α-helices, β-sheets)

    • Allows monitoring of structural changes under different conditions

    • Requires relatively small amounts of protein (0.1-0.5 mg/mL)

    • Can verify proper folding after reconstitution

  • Cryo-Electron Microscopy:

    • Allows visualization of MT-ATP6 within the ATP synthase complex

    • Can achieve near-atomic resolution in optimal cases

    • Reveals structural relationships between subunits

    • Does not require crystallization

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps solvent-accessible regions and protein dynamics

    • Identifies buried regions and interfaces with other subunits

    • Works well for membrane proteins in detergent micelles

    • Provides information about conformational changes

  • Solid-State NMR Spectroscopy:

    • Can provide atomic-level structural information in native-like lipid environments

    • Particularly useful for studying membrane-embedded regions

    • Allows analysis of dynamics and conformational changes

    • Requires isotopic labeling (¹⁵N, ¹³C)

  • Cross-linking Mass Spectrometry:

    • Identifies residues in close proximity within the protein or at interfaces

    • Validates structural models derived from other techniques

    • Can capture transient interactions

    • Compatible with detergent-solubilized proteins

The combination of these approaches has proven particularly powerful for other ATP synthase components, where the integration of low-resolution structural information with biochemical data has revealed critical mechanistic insights about rotary coupling and regulation .

How does Scyliorhinus canicula MT-ATP6 compare structurally and functionally to homologs from other species?

Comparative analysis of MT-ATP6 across species provides insights into evolutionary conservation and species-specific adaptations:

Species TypeKey Structural FeaturesFunctional AdaptationsSequence Identity to S. canicula
Mammals (Human)226-227 amino acids, higher hydrophobicity in TMHsOptimized for 37°C operation, higher ATP output~60-65%
Birds~226 amino acids, conserved proton channel residuesAdapted for higher body temperature, high metabolic rate~62-68%
Bony Fish220-230 amino acids, variable C-terminusTemperature-dependent efficiency adaptations~70-75%
Other Cartilaginous Fish227-230 amino acids, highly conserved TMHsAdapted for lower metabolic rates~80-90%
Bacterial ATP synthase subunit aShorter sequences (210-220 aa), distinct C-terminusReversible operation, environmental adaptability~25-35%

Critical residues involved in proton translocation (particularly charged amino acids within transmembrane segments) show the highest conservation across species, reflecting the fundamental importance of this function. In contrast, regions involved in species-specific regulation or adaptation to different cellular environments display greater sequence divergence .

What unique features of Scyliorhinus canicula MT-ATP6 might make it valuable for specific research applications?

Scyliorhinus canicula (small-spotted catshark) MT-ATP6 possesses several unique attributes that make it particularly valuable for specific research applications:

  • Evolutionary Position:

    • As a cartilaginous fish, S. canicula occupies an important evolutionary position between bony fishes and tetrapods

    • Studying its ATP synthase provides insights into the evolution of bioenergetic systems in vertebrates

    • May reveal ancestral features lost in more derived lineages

  • Environmental Adaptations:

    • Adapted for function in marine environments

    • Operates efficiently at lower temperatures than mammalian homologs

    • May possess unique regulatory mechanisms for energy conservation during periods of food scarcity

  • Structural Stability:

    • Often exhibits greater temperature and pH stability than mammalian counterparts

    • Potentially more amenable to structural studies and protein engineering

    • May retain function in experimental conditions that denature mammalian proteins

  • Experimental Advantages:

    • Recombinant expression yields may be higher than for human homologs

    • Less likely to contain post-translational modifications that complicate recombinant expression

    • Provides a mammalian-distinct but functionally comparable system for comparative studies

  • Biomedical Applications:

    • Non-human origin reduces potential for cross-reactivity in therapeutic development

    • Structural differences from human homolog can inform species-selective inhibitor design

    • May serve as a template for engineering ATP synthase with novel properties

These unique characteristics make S. canicula MT-ATP6 particularly valuable for comparative biochemistry, evolutionary studies, and as an alternative model system for understanding fundamental ATP synthase mechanisms .

What are the most common problems encountered when working with recombinant MT-ATP6 and how can they be resolved?

Working with recombinant MT-ATP6 presents several technical challenges that researchers commonly encounter. The following troubleshooting guide addresses the most frequent issues:

ProblemPossible CausesSolution Strategies
Low expression yieldToxicity to expression host, codon bias, improper inductionOptimize codon usage for expression host, use lower induction temperatures (16-18°C), test different E. coli strains (C41/C43 for membrane proteins), consider fusion partners (MBP, SUMO)
Inclusion body formationOverexpression, improper folding, membrane protein natureReduce induction temperature and IPTG concentration, add membrane-mimetic agents to culture, consider autoinduction protocols
Poor solubilityHydrophobic transmembrane domainsUse appropriate detergents (DDM, LDAO) for extraction, include glycerol in buffers, optimize pH and salt concentrations
Protein aggregation after purificationDetergent removal, concentration effectsMaintain minimum critical micelle concentration of detergent in all buffers, avoid excessive concentration, add stabilizing agents (glycerol, specific lipids)
Loss of activity during storageFreeze-thaw damage, oxidationAdd glycerol (50%) for storage, use oxygen scavengers if applicable, avoid repeated freeze-thaw cycles, store in small aliquots
Poor reconstitution into liposomesDetergent interference, protein aggregationCarefully control detergent removal rate, optimize protein:lipid ratios, consider native lipid composition, verify orientation in liposomes
Non-functional proteinImproper folding, missing partner subunitsCo-express with other ATP synthase subunits, verify structural integrity by CD spectroscopy, consider expression in eukaryotic systems

Early detection of these issues through quality control steps (SEC-MALS, DLS, CD spectroscopy) can save significant time and resources in downstream applications. For activity assays, always include positive control proteins with known activity to benchmark performance .

How can researchers optimize activity assays for MT-ATP6 within the ATP synthase complex?

Optimizing activity assays for MT-ATP6 within the ATP synthase complex requires careful attention to multiple parameters. The following methodology provides a systematic approach:

  • Reconstitution Optimization:

    • Test different lipid compositions (DOPC, POPE/POPG mixtures, native lipid extracts)

    • Optimize protein-to-lipid ratios (typical range: 1:50 to 1:200 w/w)

    • Control proteoliposome size through extrusion (100-200 nm typically optimal)

    • Verify reconstitution by freeze-fracture electron microscopy or density gradient centrifugation

  • Proton Gradient Establishment:

    • For ATP synthesis assays, establish ΔpH by acid-base transition or K⁺/valinomycin method

    • Quantify achieved ΔpH using pH-sensitive fluorescent dyes (ACMA, pyranine)

    • Control for passive proton leakage with appropriate controls

    • Optimize buffer composition for maximum gradient stability

  • ATP Synthesis Measurement:

    • Use real-time luciferase-based ATP detection for highest sensitivity

    • Include internal standards for accurate quantification

    • Perform initial rate measurements to avoid product inhibition

    • Control for background ATP contamination in reagents

  • Data Analysis Refinement:

    • Apply appropriate enzyme kinetics models (consider cooperativity if present)

    • Correct for background activity in control samples

    • Use technical replicates (n≥3) and biological replicates (different protein preparations)

    • Validate with known ATP synthase inhibitors as controls

  • Troubleshooting Strategy:

    • If activity is low, verify proton gradient formation independently

    • Test for inhibitory contaminants in lipids or detergents

    • Verify proper orientation of MT-ATP6 in proteoliposomes (typically 50% inside-out)

    • Consider the need for additional factors (lipids, ions) for full activity

This optimized approach has been successfully applied to mycobacterial F-ATP synthase studies, where careful attention to these parameters enabled detection of inhibitor effects in the micromolar range .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.