Recombinant Scyliorhinus canicula Cytochrome c oxidase subunit 2 (MT-CO2)

What are the optimal storage and handling conditions for Recombinant Scyliorhinus canicula MT-CO2?

For optimal preservation of Recombinant Scyliorhinus canicula MT-CO2 structural integrity and function, researchers should follow these evidence-based storage and handling protocols:

Storage Temperature Protocols:

• Store stock preparations at -20°C for routine laboratory use

• For extended storage periods, maintain at -80°C to minimize protein degradation

• Avoid repeated freeze-thaw cycles which can significantly compromise protein activity and structural integrity

Buffer Composition:
The recombinant protein is typically supplied in Tris-based buffer with 50% glycerol, optimized specifically for maintaining MT-CO2 stability . This high glycerol concentration helps prevent ice crystal formation during freezing, protecting the protein's tertiary structure.

Working Solution Handling:

• When preparing working aliquots, store at 4°C for no longer than one week

• For experimental protocols requiring multiple days, prepare fresh dilutions rather than repeatedly accessing stock solutions

Stability Considerations:
The shelf life of liquid preparations is approximately 6 months at -20°C/-80°C, while lyophilized preparations can maintain stability for up to 12 months under proper storage conditions . Researchers should document thawing events and monitor for potential activity loss in long-term studies.

These recommendations are based on empirical data from manufacturer protocols and research practices with similar mitochondrial electron transport proteins. Adherence to these guidelines will help ensure experimental reproducibility and reliable results when working with this recombinant protein.

What expression systems are most effective for producing Recombinant Scyliorhinus canicula MT-CO2, and what purification strategies yield the highest activity?

Based on comparative analysis of expression systems for mitochondrial membrane proteins, several approaches have demonstrated efficacy for MT-CO2 production:

Expression Systems Comparison:

E. coli expression systems are predominantly used for Scyliorhinus canicula MT-CO2 production as evidenced by commercial preparations . The typical protocol involves:

• Gene optimization for prokaryotic expression using codon optimization algorithms

• Cloning into expression vectors with appropriate affinity tags (typically His-tag)

• Expression in E. coli strains optimized for membrane protein production

• Cell lysis and membrane protein solubilization using specific detergents

Purification Strategy Recommendations:

For optimal purification of MT-CO2:

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for initial capture

• Ion exchange chromatography as a secondary purification step

• Size exclusion chromatography for final polishing and buffer exchange

The addition of glycerol (typically 50%) to the final storage buffer is critical for maintaining protein stability . The recombinant protein is typically tagged with an N-terminal 10xHis-tag to facilitate purification while minimizing interference with protein function .

How has the MT-CO2 gene evolved in Scyliorhinus canicula compared to other vertebrates, and what does this reveal about functional constraints?

The evolutionary trajectory of MT-CO2 in Scyliorhinus canicula provides valuable insights into the functional constraints and adaptive evolution of this critical mitochondrial gene across vertebrate lineages.

Molecular evolution studies of cytochrome oxidase genes have revealed that MT-CO2 is subject to varying selection pressures across different domains of the protein and across different taxonomic groups. In the marine copepod Tigriopus californicus, for instance, interpopulation divergence at the COII locus can reach nearly 20% at the nucleotide level, including numerous nonsynonymous substitutions, despite the protein's critical role in electron transport . This suggests that certain regions of MT-CO2 can tolerate considerable sequence variation while maintaining function.

In Scyliorhinus canicula, as a representative of the chondrichthyan lineage, MT-CO2 occupies a particularly informative phylogenetic position. Chondrichthyans (sharks, rays, and chimaeras) represent the most basal lineage of jawed vertebrates to possess the full complement of mitochondrial genes found in higher vertebrates, making them critical for understanding the ancestral state and evolutionary dynamics of these genes .

Analyses of selection pressures on MT-CO2 across vertebrates typically reveal a mixed pattern:

• Strong purifying selection (ω << 1) on residues directly involved in electron transfer and interaction with heme groups

• Relaxed selective constraints (ω ≈ 1) on approximately 4% of sites, particularly in regions that do not directly participate in catalysis

• Occasional signatures of positive selection (ω > 1) in certain lineages, possibly reflecting adaptation to different environmental conditions or co-evolution with nuclear-encoded interacting partners

The conservation pattern of MT-CO2 in Scyliorhinus canicula likely reflects these same evolutionary dynamics, with functional domains showing high conservation while peripheral regions may exhibit greater divergence. This pattern is consistent with the critical role of MT-CO2 in cellular respiration, where major structural changes could be deleterious, but minor modifications in non-catalytic regions may allow adaptation to specific physiological or environmental challenges.

How can Recombinant Scyliorhinus canicula MT-CO2 be used as a model system to study electron transport chain dysfunction?

Recombinant Scyliorhinus canicula MT-CO2 offers a unique model system for investigating electron transport chain (ETC) dysfunction for several reasons:

Evolutionary Context Benefits:
As a representative of cartilaginous fishes, Scyliorhinus canicula occupies a key phylogenetic position, making its cytochrome c oxidase components valuable for comparative studies of mitochondrial function across vertebrate evolution. The divergence of elasmobranchs predates many adaptations seen in teleost fish and tetrapods, potentially providing insights into ancestral ETC functions .

Experimental Applications:

• Structure-Function Relationship Studies:

  • Site-directed mutagenesis of conserved residues can reveal their specific contributions to electron transfer efficiency

  • Comparison with mutant phenotypes observed in human MT-CO2-related diseases can identify fundamental versus species-specific functional requirements

  • Investigation of copper binding sites and their role in electron transport can elucidate metal coordination chemistry in cytochrome oxidase

• Reconstitution Experiments:

  • Combining recombinant Scyliorhinus canicula MT-CO2 with COX subunits from other species can assess compatibility and identify critical interaction domains

  • These chimeric enzyme complexes can be used to study the basis of mitonuclear incompatibility and co-evolution of respiratory chain components

• Modeling Disease-Related Mutations:

  • Introduction of mutations corresponding to human MT-CO2 pathogenic variants into the shark protein can provide insights into disease mechanisms

  • A study found that a missense mutation in human MT-CO2 caused proximal myopathy with lactic acidosis, changing a methionine to lysine in the first membrane-spanning region of COX II

  • Similar mutations could be introduced into the shark protein to study evolutionary conservation of pathogenic mechanisms

Methodological Approaches:
For functional studies, researchers should consider:

• Spectrophotometric assays to measure enzyme activity and electron transfer rates

• Protein-protein interaction assays to evaluate assembly with other COX subunits

• Structural analysis techniques such as circular dichroism to assess protein folding and stability

• Oxygen consumption measurements to evaluate catalytic efficiency

The shark MT-CO2 system offers distinct advantages for understanding fundamental aspects of electron transport chain function that may be applicable across vertebrate species while providing evolutionary context for observed functional differences.

What experimental protocols are most effective for studying the interaction between Recombinant Scyliorhinus canicula MT-CO2 and other components of the electron transport chain?

Investigating the interactions between Recombinant Scyliorhinus canicula MT-CO2 and other components of the electron transport chain requires specialized techniques that accommodate the unique properties of membrane proteins. The following evidence-based protocols are recommended:

1. Reconstitution in Liposomes and Nanodiscs:

• Incorporate purified recombinant MT-CO2 and other purified cytochrome oxidase subunits into liposomes or nanodiscs

• This system allows controlled study of protein-protein interactions in a membrane-like environment

• Measure electron transfer rates using spectrophotometric assays with reduced cytochrome c as substrate

• Typical protocol involves:

  • Preparation of liposomes from defined phospholipid mixtures

  • Incorporation of purified proteins using detergent-mediated reconstitution

  • Assessment of complex assembly and activity

2. Surface Plasmon Resonance (SPR) Analysis:

• Immobilize recombinant MT-CO2 on sensor chips via His-tag or direct coupling

• Pass potential interaction partners (cytochrome c, other COX subunits) over the surface

• Measure association and dissociation rates to determine binding kinetics

• This approach can quantify:

  • Binding affinities (KD values)

  • Association/dissociation rates (kon/koff)

  • Effects of mutations on interaction strength

3. Crosslinking Mass Spectrometry (XL-MS):

• Use chemical crosslinkers to capture transient interactions between MT-CO2 and other proteins

• Digest crosslinked complexes and identify interaction sites by mass spectrometry

• This technique can map specific residues involved in protein-protein contacts

• Particularly valuable for identifying interaction interfaces between MT-CO2 and cytochrome c

4. Biolayer Interferometry:

• Alternative to SPR that allows real-time detection of biomolecular interactions

• Offers advantages for membrane protein studies due to simpler surface chemistry

• Can analyze interactions in various buffer conditions to assess pH or ion dependency

5. Functional Coupling Assays:

• Measure electron transfer between cytochrome c and the MT-CO2-containing complex

• Assess oxygen consumption using polarographic techniques (oxygen electrodes)

• Compare kinetics with native enzyme complexes from Scyliorhinus canicula mitochondria

Methodological Considerations:

• Detergent selection is critical for maintaining protein structure and function during purification

• Buffer conditions should mimic physiological pH and ionic strength

• Temperature control is important, with assays typically performed at 25°C for comparison purposes

• Include appropriate controls with known interacting partners to validate experimental systems

These approaches provide complementary information about both structural interaction details and functional consequences of MT-CO2 interactions with other respiratory chain components.

What are the key considerations when comparing experimental results using Recombinant Scyliorhinus canicula MT-CO2 to in vivo mitochondrial function?

Researchers must consider several critical factors when extrapolating from experiments using recombinant Scyliorhinus canicula MT-CO2 to in vivo mitochondrial function:

Structural and Functional Differences:

• Post-translational Modifications:
  Recombinant proteins produced in prokaryotic systems (E. coli) lack the post-translational modifications present in native shark mitochondria . These modifications can affect protein folding, stability, and activity. Modifications potentially missing in the recombinant protein include:

  • Phosphorylation

  • Acetylation

  • Oxidative modifications

• Lipid Environment:
  The native membrane environment contains specific phospholipids and cardiolipin that influence cytochrome oxidase activity. Reconstituted systems rarely replicate the exact lipid composition of shark mitochondrial membranes, potentially affecting:

  • Protein mobility

  • Conformational flexibility

  • Proton translocation efficiency

• Complex Assembly:
  In vivo, MT-CO2 functions as part of a multisubunit complex. Recombinant MT-CO2 studied in isolation may behave differently than when assembled with other subunits in the complete cytochrome c oxidase complex .

Experimental Design Considerations:

The following table outlines key considerations for different experimental parameters:

Analytical Approaches for Bridging the Gap:

• Compare kinetic parameters (Km, Vmax) between recombinant MT-CO2 and isolated mitochondria from Scyliorhinus canicula

• Supplement recombinant systems with mitochondrial extracts to provide missing components

• Validate findings from recombinant studies using isolated intact mitochondria when possible

• Consider tissue-specific differences in mitochondrial function within the organism

These considerations are essential for accurate interpretation of experimental results and appropriate extrapolation to in vivo mitochondrial function in Scyliorhinus canicula.

How can researchers address the challenges of comparing MT-CO2 function across different species when using recombinant proteins?

Comparative studies of MT-CO2 function across species using recombinant proteins present several methodological and interpretive challenges. The following strategies can help researchers address these challenges effectively:

Standardization of Experimental Conditions:

To enable meaningful cross-species comparisons, researchers should standardize:

• Expression Systems: Use the same expression system for all recombinant proteins being compared. Differences in expression systems (e.g., E. coli vs. insect cells) can introduce variables unrelated to intrinsic protein properties .

• Purification Protocols: Apply identical purification methodologies, including the same affinity tags (e.g., His-tag) and chromatography steps, to minimize variability in protein preparation .

• Assay Conditions: Maintain consistent buffer compositions, substrate concentrations, and assay temperatures across all comparative experiments.

Addressing Sequence and Structural Divergence:

• Phylogenetic Normalization:

  • Analyze experimental data in the context of phylogenetic relationships

  • Calculate evolutionary distances between species being compared

  • Consider using phylogenetically independent contrasts to separate functional differences from shared evolutionary history

• Domain-Specific Analysis:

  • Compare functional domains separately rather than entire proteins

  • Focus on highly conserved regions involved in catalysis

  • Analyze variable regions in the context of species-specific adaptations

Interpretation Frameworks:

When interpreting cross-species functional differences, consider:

• Environmental Adaptation:
  MT-CO2 function may reflect adaptation to different environmental conditions (temperature, oxygen availability, metabolic demands). For example, different electron transfer rates between species may represent adaptations to their specific ecological niches rather than fundamental differences in enzyme mechanism .

• Mitonuclear Compatibility:
  Recombinant MT-CO2 studied in isolation may not reflect in vivo performance due to co-evolution with species-specific nuclear-encoded components. Studies in primates have shown that mismatches between mitochondrial and nuclear components can affect enzyme kinetics .

Methodological Solutions:

• Chimeric Protein Approaches:

  • Create chimeric proteins by swapping domains between species

  • Map functional differences to specific protein regions

  • Identify critical residues through site-directed mutagenesis of non-conserved amino acids

• Reconstitution Experiments:

  • Test recombinant MT-CO2 with both conspecific and heterospecific interaction partners

  • Measure interaction energetics and functional outcomes

  • Identify compatibility constraints across species boundaries

• Complementary in silico Analyses:

  • Use molecular dynamics simulations to predict functional consequences of sequence differences

  • Apply computational modeling to identify energetically important residues

  • Conduct evolutionary rate analyses to identify sites under different selection pressures

By implementing these approaches, researchers can generate more robust and biologically meaningful comparisons of MT-CO2 function across different species, including Scyliorhinus canicula, humans, and other vertebrates.

How can Recombinant Scyliorhinus canicula MT-CO2 be used to study mitochondrial dysfunction in comparative models of metabolic disorders?

Recombinant Scyliorhinus canicula MT-CO2 presents unique opportunities for comparative studies of mitochondrial dysfunction in metabolic disorders due to several advantageous characteristics:

Evolutionary Perspective on Metabolic Adaptation:

The position of Scyliorhinus canicula (small-spotted catshark) as a representative of cartilaginous fishes provides an evolutionary reference point for understanding mitochondrial function across vertebrates. Sharks have maintained stable energy metabolism despite limited dietary resources over evolutionary timescales, suggesting potential adaptations in their mitochondrial efficiency . These adaptations may inform our understanding of human metabolic disorders in several ways:

• Comparative Substrate Utilization:

  • Sharks demonstrate efficient energy metabolism despite their irregular feeding patterns

  • Comparing enzyme kinetics of shark MT-CO2 with human counterparts may reveal differences in substrate affinity and catalytic efficiency

  • These differences could highlight evolutionary adaptations in energy conservation relevant to metabolic disorders

• Resistance to Oxidative Stress:

  • Elasmobranchs have evolved mechanisms to manage oxidative stress during irregular metabolic states

  • Studying how shark MT-CO2 functions under oxidative conditions may reveal protective mechanisms absent in human systems

Experimental Applications:

The following research approaches can leverage recombinant Scyliorhinus canicula MT-CO2 for metabolic disorder studies:

• Site-Directed Mutagenesis Models:

  • Introduce mutations corresponding to human pathogenic variants into shark MT-CO2

  • Compare the functional consequences of identical mutations across species

  • Identify conserved versus species-specific pathogenic mechanisms

  For example, pathogenic mutations in human MT-CO2 have been associated with myopathy and lactic acidosis . Introducing equivalent mutations into shark MT-CO2 could reveal whether the pathogenicity mechanisms are evolutionarily conserved or human-specific.

• Comparative Respiratory Chain Reconstitution:

  • Reconstitute cytochrome c oxidase complexes using combinations of components from different species

  • Test the functional compatibility of shark MT-CO2 with human nuclear-encoded subunits

  • Identify critical interaction domains that determine compatibility

• Metabolic Stress Response:

  • Compare the stability and function of shark versus human MT-CO2 under conditions mimicking metabolic stress

  • Assess resistance to pH changes, temperature variations, and oxidative damage

  • Identify potential protective features in shark proteins that could inform therapeutic approaches

Methodological Framework:

A comprehensive approach would involve:

• Expression of recombinant wild-type and mutant versions of both shark and human MT-CO2

• Parallel functional characterization using identical assay conditions

• Structural analysis to correlate functional differences with protein architecture

• Integration with data from cellular and organismal models of metabolic disorders

This comparative approach using Scyliorhinus canicula MT-CO2 can provide evolutionary context to human metabolic disorders, potentially revealing novel therapeutic targets and approaches based on natural adaptations present in this ancient vertebrate lineage.

How does the evolution of MT-CO2 in Scyliorhinus canicula relate to the development of MHC-based adaptive immunity in cartilaginous fishes?

The relationship between MT-CO2 evolution and MHC-based adaptive immunity in cartilaginous fishes represents an intriguing intersection between energy metabolism and immune function. While direct functional interactions remain speculative, their parallel evolution provides insights into the broader context of vertebrate physiological adaptation:

Evolutionary Context of Both Systems:

Chondrichthyans (cartilaginous fishes) represent the most basal vertebrate lineage to possess:

• A complete mitochondrial respiratory chain including MT-CO2 with structure and function similar to higher vertebrates

• An MHC-based adaptive immune system with characteristics typical of jawed vertebrates

This coincident appearance suggests potential co-evolutionary processes during the early radiation of jawed vertebrates. The small-spotted catshark (Scyliorhinus canicula) has been utilized as a model organism for studying both systems, providing valuable insights into their ancestral states.

Molecular Diversity Patterns:

Interestingly, both MT-CO2 and MHC genes in Scyliorhinus canicula exhibit characteristic evolutionary patterns:

• MT-CO2 Evolution:

  • Shows evidence of strong purifying selection in functional domains

  • Displays relaxed constraint in non-catalytic regions

  • Exhibits signatures of adaptive evolution in certain lineages

• MHC Evolution:

  • Research identified three MHC IIβ loci within the same genomic region in Scyliorhinus canicula

  • All three loci are expressed in different tissues

  • Exhibits high levels of sequence diversity, positive selection, and recombination

  • Shows evidence of copy number variation

These parallel patterns of functional conservation with selective diversification suggest both systems respond to similar evolutionary pressures, potentially related to environmental adaptation and host-pathogen interactions.

Potential Functional Connections:

While direct interaction between MT-CO2 and MHC proteins is unlikely, several indirect connections may exist:

• Energetic Support for Immune Function:
  Efficient MT-CO2 function ensures optimal ATP production necessary to support energetically demanding immune responses. Any adaptive changes in MT-CO2 that enhance energy production efficiency could indirectly support more robust immune function.

• Shared Regulatory Networks:
  Transcriptional regulation networks responding to environmental stressors may coordinate expression of both mitochondrial and immune genes, linking their functional responses.

• Co-evolutionary Responses to Pathogens:
  Some pathogens target mitochondrial function as part of their virulence strategy. Adaptive changes in MT-CO2 could represent counter-adaptations to pathogen-induced mitochondrial dysfunction, paralleling MHC adaptations to pathogen evasion strategies.

Research Approaches to Explore Connections:

Experimental approaches using recombinant Scyliorhinus canicula MT-CO2 could include:

• Comparative expression analysis of MT-CO2 and MHC genes across tissues and during immune challenges

• Assessment of mitochondrial function in immune cells during activation

• Evolutionary rate correlation analyses between MT-CO2 and MHC genes across cartilaginous fish species

• Functional studies of MT-CO2 variants in the context of immune cell energy metabolism

Understanding the potential relationship between these two systems could provide insights into the broader evolutionary context of vertebrate physiology and the interconnections between fundamental cellular processes.

What can the sequence and function of Scyliorhinus canicula MT-CO2 tell us about the adaptation of cellular respiration to the marine environment?

The sequence and functional characteristics of Scyliorhinus canicula MT-CO2 provide a valuable window into the evolutionary adaptations of cellular respiration to the marine environment, particularly in the context of the ancient lineage of cartilaginous fishes:

Marine-Specific Adaptations in Sequence:

Analysis of the Scyliorhinus canicula MT-CO2 amino acid sequence (MAHPSQLGFQDAASPVMEELIHFHDHTLMIVFLISTLVLYIITAMVSTKLTNKYILDSQEIEIVWTILPAIILIMIALPSLRILYLMDEINDPHLTIKAMGHQWYWSYEYTDYEDLGFDSYMIQTQDLTPGQFRLLETDHRMVVPMESPIRVLVSAEDVLHAWAVPALGVKMDAVPGRLNQTAFIISRPGVYYGQCSEICGANHSFMPIVVEAVPLEHFETWSSLMLEEA) reveals several features that may represent adaptations to the marine environment:

• Transmembrane Domain Composition:
  The hydrophobic residues in the transmembrane domains are arranged to maintain structural integrity in the specific ionic conditions of marine organisms' mitochondria. The first membrane-spanning region (HTLMIVFLISTLVLYIITAMVST) contains a high proportion of branched aliphatic residues (isoleucine, leucine, valine) that provide stability in the lipid bilayer.

• Surface Charge Distribution:
  Marine organisms face different ionic strength environments compared to freshwater or terrestrial species. The distribution of charged residues in the water-exposed regions of MT-CO2 may reflect adaptations to these conditions.

• Thermal Stability Elements:
  Regions that contribute to thermal stability may show adaptations reflecting the relatively stable temperature environment that marine elasmobranchs inhabit compared to many teleost fishes or terrestrial vertebrates.

Functional Implications for Marine Adaptation:

Several functional aspects of MT-CO2 may represent specific adaptations to the marine environment:

• Oxygen Affinity:
  Marine environments, particularly those inhabited by benthic species like Scyliorhinus canicula, can experience variable oxygen levels. The structure of the oxygen reduction site and electron transfer pathway in MT-CO2 may be optimized for function under these conditions.

• Osmotic and Ionic Regulation:
  The proton-pumping function of cytochrome c oxidase contributes to the electrochemical gradient across the inner mitochondrial membrane. In marine elasmobranchs, which maintain internal osmolarity through unique osmoregulatory strategies, this function may be specially adapted.

• Energy Efficiency:
  The lifestyle of Scyliorhinus canicula involves periods of low activity and intermittent feeding. The efficiency of MT-CO2 in coupling electron transfer to proton pumping may reflect adaptations to this energy utilization pattern, balancing ATP production against oxygen consumption.

Comparative Framework:

To fully understand these adaptations, comparative studies between recombinant Scyliorhinus canicula MT-CO2 and homologs from other environments would be valuable:

These comparative studies could identify specific residues and structural features that have evolved in response to different marine environments, providing insights into both the evolution of cellular respiration and the mechanisms of adaptation to marine conditions across vertebrate lineages.

What are the most promising future research directions for understanding MT-CO2 function in the context of elasmobranch evolution and physiology?

Several promising research directions stand to significantly advance our understanding of MT-CO2 function in elasmobranchs, with implications for both evolutionary biology and comparative physiology:

1. Integrated Multi-omics Approaches:

Combining multiple molecular techniques to create a comprehensive picture of MT-CO2 function in its biological context:

• Comparative Transcriptomics: Analyze expression patterns of MT-CO2 alongside nuclear-encoded respiratory chain components across different tissues, developmental stages, and physiological states in Scyliorhinus canicula

• Proteomic Analysis: Identify post-translational modifications of native MT-CO2 in shark mitochondria and compare with recombinant versions to understand regulatory mechanisms

• Metabolomics: Correlate MT-CO2 activity with broader metabolic profiles to understand its role in elasmobranch energy metabolism

This integrated approach would reveal how MT-CO2 function is coordinated with broader physiological processes and evolutionary adaptations specific to elasmobranchs.

2. Structural Biology Advancements:

Apply cutting-edge structural biology techniques to elucidate the detailed architecture of elasmobranch MT-CO2:

• Cryo-electron Microscopy: Determine high-resolution structures of the complete cytochrome c oxidase complex from Scyliorhinus canicula, focusing on unique features compared to mammalian homologs

• Molecular Dynamics Simulations: Model the dynamics of electron and proton transfer within the context of elasmobranch-specific sequence variations

• In silico Mutational Analysis: Predict the functional consequences of sequence variations between elasmobranchs and other vertebrates

These approaches would link structural features to functional properties and evolutionary adaptations.

3. Environmental Adaptation Studies:

Investigate how MT-CO2 function relates to the specific environmental challenges faced by elasmobranchs:

• Oxygen Affinity Comparisons: Compare oxygen binding and reduction kinetics between species from different habitats (deep-sea vs. coastal)

• Temperature Adaptation: Analyze MT-CO2 activity across temperature ranges relevant to different elasmobranch species' habitats

• Anthropogenic Stressor Responses: Examine how pollutants, climate change factors, and other human-induced environmental changes affect MT-CO2 function

These studies would connect molecular function to ecological adaptation and conservation concerns.

4. Evolutionary Medicine Applications:

Leverage elasmobranch MT-CO2 research for insights into human mitochondrial diseases:

• Comparative Pathogenic Mutation Analysis: Study equivalent pathogenic mutations in shark and human MT-CO2 to identify conserved versus divergent disease mechanisms

• Compensatory Mechanism Identification: Investigate natural compensatory mechanisms in shark mitochondria that might inform therapeutic approaches for human mitochondrial disorders

• Cancer Metabolism Insights: Explore how the unique metabolic adaptations of elasmobranchs, potentially involving MT-CO2, might inform cancer metabolism research

This translational approach could yield valuable insights for human health while advancing basic understanding of elasmobranch physiology.

5. Developmental Biology Perspectives:

Examine the role of MT-CO2 in elasmobranch development:

• Embryonic Expression Patterns: Characterize MT-CO2 expression during embryogenesis, particularly in the context of the unusual reproductive strategies of elasmobranchs

• Maternal-Embryonic Transfer: Investigate the mechanisms of mitochondrial transfer and inheritance in viviparous and oviparous shark species

• Energetic Requirements During Development: Correlate MT-CO2 activity with the energy demands of different developmental stages

These studies would connect mitochondrial function to the unique reproductive biology of elasmobranchs.

Each of these research directions would benefit from the availability of recombinant Scyliorhinus canicula MT-CO2 as a tool for comparative and functional studies, complementing investigations with native proteins and whole-organism approaches.

How might advances in protein engineering be applied to enhance the utility of Recombinant Scyliorhinus canicula MT-CO2 for structural and functional studies?

Protein engineering approaches offer significant potential to enhance the utility of Recombinant Scyliorhinus canicula MT-CO2 for both fundamental and applied research. The following cutting-edge strategies could overcome current limitations and expand research applications:

1. Enhanced Expression and Stability Engineering:

Current challenges with membrane protein expression and stability could be addressed through:

• Directed Evolution: Apply iterative rounds of mutation and selection to identify variants with improved expression levels and stability in heterologous systems

• Consensus Design: Create engineered variants based on consensus sequences across multiple elasmobranch species to enhance core stability while maintaining functional properties

• Computational Stability Prediction: Use algorithms to identify destabilizing residues for targeted mutagenesis

• Soluble Domain Engineering: Create chimeric constructs that preserve key functional domains while improving solubility properties

These approaches could significantly increase protein yield and stability, facilitating structural studies that currently face limitations due to protein production challenges.

2. Structural Determination Enhancements:

Several engineering strategies could specifically enhance structural studies:

• Crystallization Chaperones: Fusion with crystallization-promoting domains such as T4 lysozyme or BRIL to facilitate crystal formation

• Conformational Stabilization: Introduction of disulfide bridges or other stabilizing interactions to lock the protein in specific functional states for structural analysis

• Surface Entropy Reduction: Mutation of flexible surface residues to reduce entropy and promote crystal contacts

• Nanobody Recognition Enhancement: Engineer epitopes to improve binding of structural determination tools like nanobodies

These modifications could enable high-resolution structural studies of MT-CO2 in different functional states, providing crucial insights into electron transfer mechanisms.

3. Functional Probes and Sensors:

Engineering MT-CO2 as a platform for functional studies:

• Site-Specific Fluorophore Incorporation: Introduction of unnatural amino acids with fluorescent properties at strategic locations to monitor conformational changes during catalysis

• FRET Pair Integration: Engineering cysteine residues for site-specific labeling with FRET donors and acceptors to measure intra-protein distances during function

• Electron Transfer Reporting: Creation of variants with spectroscopic properties that report on electron transfer events in real-time

• Redox-Sensitive Tags: Incorporation of domains that change properties in response to the redox state of the protein

These approaches would transform MT-CO2 into a probe for studying its own function with unprecedented temporal and spatial resolution.

4. Interaction Surface Engineering:

Modifying protein interfaces to study and control interactions:

• Affinity Enhancement: Engineer the cytochrome c binding surface to create variants with altered substrate affinities

• Cross-Species Compatibility: Modify interaction surfaces to enhance or restrict compatibility with components from different species

• Assembly Control: Engineer conditional assembly systems that allow controlled formation of the complete cytochrome c oxidase complex

These modifications would enable detailed studies of how MT-CO2 interacts with other components of the respiratory chain.

5. Advanced Bioorthogonal Chemistry Applications:

Leveraging chemical biology approaches:

• Click Chemistry Integration: Introduction of click chemistry handles for controlled modification with various probes

• Photo-Crosslinking Residues: Incorporation of photo-activatable crosslinkers to capture transient interaction partners

• Caged Activity: Engineering variants with chemically or optically removable inhibitory elements to allow precise temporal control of activity

These approaches would expand the experimental toolkit for studying MT-CO2 function in complex systems.

Implementation Strategy:

To maximize success, these engineering approaches should be:

• Guided by comparative sequence analysis across elasmobranch species

• Informed by homology models based on high-resolution structures of cytochrome c oxidase from other species

• Validated through functional assays to ensure engineered variants maintain relevant catalytic properties

• Applied incrementally with careful documentation of effects on native functions