Recombinant Scyliorhinus canicula NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Disease Modeling

  • Leber’s Hereditary Optic Neuropathy (LHON): The T10663C mutation (Val65Ala) in MT-ND4L disrupts Complex I activity, linking it to optic nerve degeneration .

  • Metabolic Disorders: Variants correlate with obesity and diabetes, highlighting its role in mitochondrial dysfunction .

Enzyme Replacement Studies

  • Complex I Deficiency: Recombinant ND4L aids in restoring electron transport chain activity. Studies in Chlamydomonas reinhardtii show that ND4L suppression abolishes Complex I assembly .

  • Therapeutic Potential: Expression of yeast NDI1 (a homolog) in mammalian cells rescues rotenone-induced toxicity, suggesting ND4L’s utility in gene therapy .

Key Research Findings

  • Assembly Dependency: ND4L is essential for assembling the 950-kDa Complex I structure. Its absence prevents functional enzyme formation .

  • Conservation: Despite gene transfer to the nucleus in some species (e.g., Chlamydomonas), ND4L retains conserved hydrophobic domains critical for proton translocation .

  • Structural Insights: ND4L’s transmembrane helices stabilize the interaction between ND2 and ND4 subunits, maintaining Complex I integrity .

Future Directions

  • Structural Biology: Cryo-EM studies to map ND4L’s role in proton channeling.

  • Gene Therapy: Optimizing ND4L delivery vectors for mitochondrial disorders.

  • Drug Screening: Using recombinant ND4L to identify Complex I modulators for metabolic diseases.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
Target Names
Target Protein Sequence
MSPMYFSFSSAFMLGLMGLAFNRSHLLSALLCLEGMMLTLFVATATWSLMLNSTSSSILP MILLTFSACEASAGLAILVATSRSHGSDNLQNLNLLQC
Uniprot No.

Target Background

Function
This protein is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be essential for the minimal assembly required for catalysis. Complex I plays a crucial role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its fundamental role in mitochondrial function?

MT-ND4L (NADH-ubiquinone oxidoreductase chain 4L) is a protein encoded by the mitochondrial genome that serves as an essential component of Complex I in the electron transport chain. In Scyliorhinus canicula (Small-spotted catshark), this protein consists of 98 amino acids and plays a crucial role in the initial electron transfer step during oxidative phosphorylation .

The protein functions specifically within Complex I, which is embedded in the inner mitochondrial membrane. During cellular respiration, MT-ND4L contributes to the transfer of electrons from NADH to ubiquinone, creating an electrochemical gradient across the membrane that drives ATP production . This energy conversion process is fundamental to cellular metabolism across eukaryotic organisms.

How are recombinant versions of MT-ND4L typically produced and purified for research applications?

Recombinant MT-ND4L from Scyliorhinus canicula is typically produced through heterologous expression in E. coli systems using specialized vectors that accommodate the protein's hydrophobic characteristics . The common methodology involves:

  • Expression system selection: E. coli is frequently used due to its high yield and cost-effectiveness for mitochondrial proteins .

  • Vector design: Constructs typically include a His-tag for simplified purification, often positioned at the N-terminus to minimize interference with protein function .

  • Expression conditions: Optimization of temperature, IPTG concentration, and incubation time to balance protein yield and solubility.

  • Purification protocol:

    • Initial cell lysis in Tris-based buffers

    • Affinity chromatography using the His-tag

    • Quality assessment via SDS-PAGE (>90% purity is typically achieved)

    • Final formulation in stabilizing buffers containing glycerol (often 50%)

  • Storage preparation: The purified protein is commonly lyophilized or stored in solution with 6% trehalose and glycerol at -20°C or -80°C to maintain stability .

When working with this hydrophobic membrane protein, researchers should be particularly attentive to solubilization conditions and avoid repeated freeze-thaw cycles to preserve functional integrity .

What are the optimal storage and handling conditions for maintaining MT-ND4L stability and function?

Maintaining the stability and functionality of recombinant MT-ND4L requires specific handling protocols due to its membrane protein characteristics:

Optimal Storage Conditions:

  • Primary storage at -20°C/-80°C in aliquoted formats to prevent repeated freeze-thaw cycles

  • Working aliquots can be maintained at 4°C for up to one week

  • For long-term storage, a final glycerol concentration of 50% is recommended

Buffer Composition:

  • Tris/PBS-based buffers (pH 8.0) with 6% trehalose provide optimal stability

  • The addition of glycerol at 5-50% (with 50% being optimal) helps prevent protein denaturation during freeze-thaw cycles

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to the recommended final concentration

  • Aliquot into single-use volumes to minimize freeze-thaw cycles

When preparing for experimental use, researchers should validate protein activity through functional assays rather than relying solely on SDS-PAGE purity assessment, as membrane proteins can lose function while maintaining apparent structural integrity.

What experimental approaches best elucidate MT-ND4L's contribution to Complex I activity?

To investigate MT-ND4L's specific role within Complex I, researchers typically employ multiple complementary approaches:

Biochemical Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurements using spectrophotometric methods

  • Oxygen consumption rate determination using Clark-type electrodes or Seahorse analyzers

  • Isolated mitochondria vs. whole cell analyses to distinguish direct effects

Structural Biology Techniques:

  • Cryo-electron microscopy to visualize MT-ND4L positioning within Complex I

  • Cross-linking studies to identify protein-protein interactions with other subunits

  • Molecular dynamics simulations to predict functional domains

Genetic Manipulation Strategies:

  • Site-directed mutagenesis targeting conserved residues

  • Comparing wild-type and mutant proteins in reconstituted systems

  • Complementation studies in cellular models with MT-ND4L knockdown/knockout

For meaningful insights, researchers should design experiments that can differentiate between MT-ND4L's direct catalytic contributions versus structural roles within Complex I assembly and stability.

How can researchers address discrepancies between different mitochondrial DNA sequencing platforms when analyzing MT-ND4L?

Researchers frequently encounter discrepancies when sequencing mitochondrial genes like MT-ND4L using different platforms. Based on comparative studies of whole-exome sequencing, whole-genome sequencing, and Sanger sequencing, the following methodological approach is recommended:

Sources of Sequencing Discrepancies:

  • Coverage limitations, particularly at the beginning and end of mitochondrial genes (especially when average mtDNA coverage is <10×)

  • Repeated poly-C sequencing errors in next-generation sequencing (NGS) data

  • Alignment errors in regions with insertions/deletions (INDELS)

  • Differences in variant calling algorithms between platforms

Recommended Validation Strategy:

Sequencing MethodStrengthsLimitationsBest Applications
Sanger SequencingHigh accuracy for individual variantsLabor-intensive, lower throughputValidation of specific variants
Whole-Exome SequencingCost-effective, good coverageKit-dependent coverage variabilityInitial variant discovery
Whole-Genome SequencingComprehensive coverageHigher cost, potential for sequencing errorsGold standard for complete analysis

Verification Protocol:

  • For critical variants, use at least two independent sequencing technologies

  • For exome sequencing of mtDNA, the Nextera Rapid Capture Exome kit demonstrated superior detection rates (87%) compared to the TruSeq Exome Enrichment kit (70%)

  • Pay particular attention to regions prone to alignment errors (e.g., positions MT:302, MT:309, and MT:310)

  • Implement specialized bioinformatics pipelines designed for mitochondrial variant calling

Research has shown that exome sequencing can detect approximately 77% of mtDNA variants identified by Sanger sequencing, making it a cost-effective alternative for mitochondrial studies when appropriate validation is performed .

What is the evidence linking MT-ND4L variants to metabolic disorders such as obesity?

Recent research has identified specific MT-ND4L variants with potential roles in metabolic disease pathogenesis:

Key Research Findings:

  • The missense mutation MT:10609T > C in the MT-ND4L gene was negatively correlated with obesity risk in controlled studies

  • This suggests a potential protective effect of this specific variant against obesity development

  • The association highlights MT-ND4L's possible role in metabolic regulation beyond its known function in oxidative phosphorylation

Proposed Mechanisms:

  • Altered efficiency of electron transport affecting ATP production

  • Modified reactive oxygen species (ROS) generation influencing cellular signaling

  • Potential impact on mitochondrial dynamics and bioenergetic adaptation

Research Considerations:
When investigating MT-ND4L variants in metabolic disorders, researchers should:

  • Account for nuclear-mitochondrial genetic interactions

  • Consider tissue-specific effects (adipose vs. muscle vs. liver)

  • Evaluate both direct bioenergetic impacts and secondary metabolic adaptations

  • Control for population stratification and haplogroup effects

This research direction demonstrates how fundamental mitochondrial components like MT-ND4L may contribute to complex polygenic conditions through bioenergetic mechanisms .

How does MT-ND4L contribute to mitochondrial disease pathogenesis, particularly in conditions like Leber hereditary optic neuropathy?

MT-ND4L mutations have been implicated in mitochondrial diseases, most notably Leber hereditary optic neuropathy (LHON):

Specific Disease-Associated Variants:

  • The T10663C (Val65Ala) mutation in MT-ND4L has been identified in several families with LHON

  • This mutation changes valine to alanine at position 65, potentially affecting protein function or stability

Pathophysiological Mechanisms:

  • Disruption of Complex I assembly or stability

  • Reduced electron transfer efficiency leading to ATP deficiency

  • Increased ROS production causing oxidative damage

  • Tissue-specific vulnerability, particularly in optic nerve tissue with high energy demands

Research Approaches:

  • Patient-derived cellular models (fibroblasts, induced pluripotent stem cells)

  • Transmitochondrial cybrid studies to isolate mitochondrial genetic effects

  • Tissue-specific expression studies focusing on affected tissues

  • Biochemical assessment of Complex I function in the presence of mutations

While the exact mechanisms linking MT-ND4L mutations to the vision loss characteristic of LHON remain incompletely understood , the study of these disease-associated variants provides valuable insights into both pathogenic processes and normal MT-ND4L function.

What experimental models are most appropriate for studying MT-ND4L function in relation to human disease?

Selecting appropriate experimental models is crucial for translating MT-ND4L research to human disease applications:

Cellular Models:

  • Transmitochondrial cybrids (nuclear background control with variable mtDNA)

  • Patient-derived fibroblasts (accessible primary cells with disease mutations)

  • Differentiated iPSCs (tissue-specific phenotype expression)

  • CRISPR-engineered cell lines (precise genetic modifications)

Animal Models:

  • Limitations exist for direct mtDNA editing in animals

  • Heteroplasmy models through selection techniques

  • Conditional knockout of nuclear-encoded interacting partners

Comparative Species Approaches:

  • Scyliorhinus canicula (small-spotted catshark) provides evolutionary insights

  • Conservation analysis across species helps identify critical functional domains

  • The full mitochondrial genomes of related species like Peristediidae fish provide comparative data for evolutionary studies

In Vitro Reconstitution:

  • Recombinant protein incorporation into liposomes or nanodiscs

  • Complex I reconstitution systems for functional studies

  • Membrane-mimetic environments for structural studies

The optimal research strategy typically involves multiple models to balance physiological relevance with experimental control. When working with mitochondrial proteins like MT-ND4L, researchers must consider nuclear-mitochondrial interactions, heteroplasmy levels, and tissue-specific effects to effectively model human disease.

What quality control methods should be used to verify recombinant MT-ND4L identity and functionality?

Comprehensive quality control for recombinant MT-ND4L requires multiple analytical approaches:

Purity and Identity Verification:

  • SDS-PAGE analysis with >90% purity threshold

  • Western blotting with specific antibodies

  • Mass spectrometry for precise molecular weight verification and post-translational modification analysis

  • N-terminal sequencing to confirm sequence integrity

Functional Assessment:

  • NADH:ubiquinone oxidoreductase activity assays

  • Reconstitution into proteoliposomes to test membrane integration

  • Protein-protein interaction studies with other Complex I components

  • Circular dichroism to verify secondary structure integrity

Stability Testing:

  • Thermal shift assays to determine stability under various conditions

  • Time-course activity measurements at different storage temperatures

  • Freeze-thaw stability assessment

Researchers should establish batch-to-batch consistency metrics and maintain reference standards for comparative quality assessment, particularly when working with membrane proteins that can appear structurally intact by some measures while having compromised functionality.

How can researchers optimize sequencing protocols specifically for MT-ND4L and other mitochondrial genes?

Mitochondrial gene sequencing presents unique challenges that require specialized protocols:

Technical Challenges:

  • Heteroplasmy detection (mixed populations of mtDNA)

  • Nuclear mitochondrial DNA segments (NUMTs) contamination

  • Highly polymorphic nature of mtDNA

  • Secondary structure formation affecting sequencing quality

Optimized Sequencing Protocol:

  • Sample Preparation:

    • Enrichment of mitochondrial fraction before DNA extraction

    • Long-range PCR to avoid NUMT amplification

    • Use of high-fidelity polymerases to minimize error rates

  • Sequencing Approach Selection:

    • For comprehensive analysis: Whole-genome sequencing provides superior coverage

    • For cost-effectiveness: Whole-exome sequencing with Nextera Rapid Capture Exome kit shows better mtDNA coverage (87% variant detection) compared to TruSeq Exome Enrichment kit (70%)

    • For targeted verification: Sanger sequencing remains the gold standard

  • Bioinformatic Analysis:

    • Use specialized mitochondrial genome assembly pipelines

    • Implement low heteroplasmy detection algorithms (typically 1-5%)

    • Account for circular genome in alignment algorithms

    • Pay special attention to regions prone to sequencing errors (e.g., MT:302, MT:309, and MT:310)

  • Verification Strategy:

    • Cross-validation between different sequencing platforms

    • Confirmation of critical variants with orthogonal methods

    • Deep sequencing for accurate heteroplasmy quantification

By implementing these specialized protocols, researchers can achieve more reliable sequencing results for MT-ND4L and other mitochondrial genes, minimizing discrepancies between different sequencing approaches .

What emerging technologies show promise for advancing MT-ND4L research?

Several cutting-edge technologies are poised to significantly advance MT-ND4L research:

Single-Molecule Techniques:

  • Nanopore sequencing for direct mtDNA analysis without amplification

  • Single-molecule FRET for real-time conformational dynamics

  • Optical tweezers for measuring protein-protein interaction forces within Complex I

Advanced Imaging Technologies:

  • Super-resolution microscopy to visualize mitochondrial substructures

  • Cryo-electron tomography for in situ structural analysis

  • Label-free imaging techniques for non-invasive functional assessment

Gene Editing Approaches:

  • Mitochondrially-targeted nucleases for direct mtDNA editing

  • Base editing technologies adapted for mitochondrial applications

  • RNA-based approaches for modulating MT-ND4L expression

Systems Biology Integration:

  • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

  • Machine learning algorithms for predicting variant pathogenicity

  • Network analysis tools for understanding mitochondrial-nuclear crosstalk

These emerging technologies will enable researchers to move beyond correlative observations toward mechanistic understanding of MT-ND4L function in both normal physiology and disease states.

How might MT-ND4L research contribute to understanding evolutionary aspects of mitochondrial function?

MT-ND4L research offers valuable insights into mitochondrial evolution:

Evolutionary Conservation Patterns:

  • Analysis of MT-ND4L across species reveals functionally critical domains

  • Comparison with nuclear-encoded Complex I subunits illuminates co-evolutionary constraints

  • The complete mitochondrial genomes of related species like Peristediidae fish provide valuable comparative data

Adaptation to Environmental Niches:

  • Species-specific variants may reflect metabolic adaptations to environmental conditions

  • Comparing MT-ND4L from Scyliorhinus canicula with other marine species could reveal adaptations to depth, temperature, or oxygen availability

Mitochondrial-Nuclear Co-evolution:

  • Interactions between MT-ND4L and nuclear-encoded Complex I components highlight evolutionary constraints

  • Species incompatibilities in hybrid models can reveal co-evolutionary requirements

Methodological Approaches:

  • Comparative genomics across diverse taxonomic groups

  • Reconstruction of ancestral sequences to test evolutionary hypotheses

  • Molecular clock analyses to date key evolutionary innovations

  • Functional testing of variants from different species in standardized systems

This evolutionary perspective not only enhances our understanding of fundamental biology but may also provide insights into human disease vulnerabilities and potential therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.