Recombinant Scyliorhinus canicula Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Biological Role in S. canicula

  • Retinal Function: S. canicula possesses a rod-dominated retina, with rhodopsin as the sole visual opsin in adults .

  • Adaptation: Enables low-light vision in benthic environments, critical for this nocturnal predator .

  • Developmental Expression: Transcriptomic studies reveal rho expression in mature rods and precursors, suggesting ongoing postnatal rod generation .

Production Methods

Expression Systems:

  1. HEK293S GnTI(-) Cells:

    • Tetracycline-inducible system yields ~6 mg/L of functional rhodopsin .

    • Produces Man₅GlcNAc₂ glycosylation, simplifying structural studies .

  2. Prokaryotic Systems:

    • E. coli expression generates untagged or His-tagged protein .

    • Lower glycosylation fidelity but cost-effective for bulk production .

Purification:

  • Affinity chromatography (e.g., Ni-NTA for His-tagged variants) .

  • Purity >90% verified by SDS-PAGE .

Research Applications

  • Disease Modeling: Study retinal degeneration mechanisms (e.g., mutations causing misfolding) .

  • Evolutionary Studies: Compare spectral tuning sites (e.g., S. canicula vs. Greenland shark rhodopsin) .

  • Structural Biology: Crystallography and cryo-EM to resolve activation mechanisms .

Key Research Findings

  1. Single-Cell Transcriptomics:

    • rho expression distinguishes mature rods from precursors in postnatal S. canicula retinas .

    • Co-expressed with pdc-l and pde6a, markers of phototransduction .

  2. Genetic Conservation:

    • Spectral tuning sites (e.g., residues 94, 178) differ from deep-sea sharks, reflecting adaptive divergence .

  3. Functional Studies:

    • Constitutively active mutants (e.g., E113Q/E134Q/M257Y) require inducible expression due to toxicity .

Challenges and Future Directions

  • Glycosylation Variability: Eukaryotic vs. prokaryotic systems affect post-translational modifications .

  • Thermal Stability: Mutational studies needed to enhance stability for structural assays .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Scyliorhinus canicula (Small-spotted catshark) (Squalus canicula)
Target Names
rho
Target Protein Sequence
MNGTEGENFYIPMSNKTGVVRSPFDYPQYYLAEPWKFSVLAAYMFFLIIAGFPVNFLTLY VTIQHKKLRQPLNYILLNLAVADLFMIFGGFPSTMITSMNGYFVFGPSGCNFEGFFATLG GEIGLWSLVVLAIERYVVVCKPMSNFRFGSQHAFMGVGLTWIMAMACAFPPLVGWSRYIP EGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFSIPLTIIFFCYGRLVCTVKEAAAQQQES ETTQRAEREVTRMVIIMVIAFLICWLPYASVAFFIFCNQGSEFGPIFMTIPAFFAKAASL YNPLIYILMNKQFRNCMITTICCGKNPFEEEESTSASASKTEASSVSSSQVAPA
Uniprot No.

Target Background

Function
Photoreceptor required for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish use 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the molecular structure of Scyliorhinus canicula rhodopsin?

Scyliorhinus canicula rhodopsin (opsd_scyca) is a G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) family of sensory receptors . The protein consists of 340 amino acids organized into the characteristic seven-transmembrane domain structure of GPCRs . The protein includes:

  • An N-terminal domain (residues 1-30)

  • Seven transmembrane domains (TM1-TM7)

  • Three extracellular loops (ECL1-ECL3)

  • Three intracellular loops (ICL1-ICL3)

  • A C-terminal domain (residues 312-340)

  • An amphipathic helix (H8) between TM7 and the C-terminus

The transmembrane domains form the core structure of the protein and contain many hydrophobic residues that anchor the protein within the cell membrane. These domains are connected by alternating intracellular and extracellular loops that contribute to both structural stability and functional interactions with other proteins .

What is the expression pattern of rhodopsin in Scyliorhinus canicula?

Rhodopsin (rho) shows extremely high and exclusive expression in the eye of Scyliorhinus canicula . Transcriptomic analyses across multiple tissues have confirmed this eye-specific expression pattern. In contrast, another visual opsin gene, rh2, shows very low expression levels in all tissues sampled from adult specimens .

Interestingly, in situ hybridization studies have demonstrated that rh2 is expressed in the poorly differentiated retina of stage 31 embryos but not in juvenile stages, suggesting a transient expression pattern during early retinal development . This indicates that while embryonic development may involve multiple opsins, the adult shark relies primarily on rhodopsin for visual functions.

How does Scyliorhinus canicula rhodopsin compare to other vertebrate visual opsins?

Scyliorhinus canicula possesses a simplified visual opsin repertoire compared to many other vertebrates. While most jawed vertebrates have multiple visual opsins (rhodopsin, SWS1, SWS2, and LWS/MWS), the small-spotted catshark possesses only rhodopsin as the functional visual pigment in adults .

The other visual opsin genes have been lost at different points in chondrichthyan evolution:

  • SWS genes are absent in all chondrichthyans

  • LWS/MWS genes have been lost more recently and are still found in some shark species

This simplified opsin repertoire correlates with the finding that the adult small-spotted catshark eye contains only rod cells, lacking the cone photoreceptors that typically express other visual opsins in vertebrates .

What expression systems are most effective for producing functional recombinant Scyliorhinus canicula rhodopsin?

When expressing recombinant S. canicula rhodopsin, several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesLimitationsYield (mg/L)Functional Activity
HEK293 cellsMammalian post-translational modifications, proper foldingHigher cost, slower growth1-580-95%
COS-7 cellsEfficient for visual GPCR expressionVariable glycosylation patterns0.5-375-90%
Sf9 insect cellsHigher protein yields, cost-effectiveDifferent glycosylation5-1570-85%
Pichia pastorisHigh density culture, inducible promotersMay require refolding10-5050-70%

For rhodopsin structural and functional studies, mammalian expression systems (particularly HEK293 cells) are preferred despite lower yields, as they typically produce protein with native-like folding and post-translational modifications. The addition of 9-cis or 11-cis retinal to the culture medium or during purification is essential for obtaining functional visual pigment.

For expression in HEK293 cells, a methodological approach should include:

  • Codon optimization for mammalian expression

  • Addition of an N-terminal signal sequence and C-terminal affinity tag (His6 or 1D4 epitope)

  • Transfection using lipofection or calcium phosphate methods

  • Culture in DMEM supplemented with 10% FBS

  • Addition of 5 μM 11-cis retinal during expression or purification

  • Solubilization with mild detergents such as DDM (n-dodecyl-β-D-maltoside) or LMNG

How can I optimize the purification protocol for recombinant Scyliorhinus canicula rhodopsin while maintaining protein stability?

Purification of recombinant S. canicula rhodopsin requires careful consideration of the protein's stability and functional properties. A step-by-step purification protocol optimized for maintaining stability would include:

  • Solubilization:

    • Harvest cells 48-72 hours post-transfection

    • Resuspend in buffer containing 50 mM HEPES pH 7.4, 150 mM NaCl

    • Solubilize membranes with 1% DDM or 0.5% LMNG for 1 hour at 4°C

  • Affinity Chromatography:

    • For His-tagged constructs: Use Ni-NTA resin with imidazole gradient elution (10-250 mM)

    • For 1D4-tagged constructs: Use CNBr-activated Sepharose coupled to 1D4 antibody

    • Conduct all purification steps under dim red light to prevent photobleaching

  • Buffer Optimization:

    • Use stabilizing additives: 0.1-0.2% cholesteryl hemisuccinate, 2 mM MgCl₂

    • Maintain detergent above CMC: 0.05% DDM or 0.01% LMNG

    • Include 10% glycerol to prevent protein aggregation

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 column

    • Elution buffer: 20 mM HEPES pH 7.4, 150 mM NaCl, detergent at 2× CMC

  • Storage Considerations:

    • Store at -80°C in 20% glycerol

    • Avoid repeated freeze-thaw cycles

    • For experiments requiring retinal-free opsin, use hydroxylamine bleaching followed by re-purification

This protocol typically yields protein with >90% purity as assessed by SDS-PAGE and high functional activity as measured by absorbance ratio (A280/A500).

What spectroscopic characteristics distinguish Scyliorhinus canicula rhodopsin from mammalian rhodopsins?

Spectroscopic analysis of shark rhodopsins, including S. canicula, reveals distinctive properties that reflect their adaptation to marine environments:

PropertyS. canicula RhodopsinBovine RhodopsinHuman Rhodopsin
Absorption maximum (λmax)496-499 nm498 nm495-498 nm
Meta I intermediate λmax~480 nm478 nm478 nm
Meta II intermediate λmax~380 nm380 nm380 nm
Thermal stability (t1/2 at 37°C)~120 minutes~40 minutes~30 minutes
pH sensitivity of Meta I/II equilibriumShifted toward Meta I at acidic pHStandard equilibriumStandard equilibrium

Recombinant S. canicula rhodopsin typically exhibits greater thermal stability than mammalian rhodopsins, likely reflecting adaptation to the cooler environment of deep marine waters. Spectroscopic measurements should be conducted in appropriate buffer systems (typically PBS pH 7.4 with 0.05% DDM) using UV-visible spectrophotometry with temperature control.

For precise determination of spectral properties, purified rhodopsin samples should be measured before and after photobleaching with light >495 nm. Difference spectra reveal the characteristic rhodopsin absorption profile. Meta intermediate kinetics can be measured using flash photolysis followed by time-resolved spectroscopy.

What strategies can be employed to investigate structure-function relationships in Scyliorhinus canicula rhodopsin?

Several complementary approaches can be used to investigate structure-function relationships in S. canicula rhodopsin:

  • Site-directed mutagenesis:

    • Target conserved residues identified through sequence alignment with other vertebrate rhodopsins

    • Focus on residues in:

      • Retinal binding pocket (e.g., K296, counterion E113)

      • G-protein interaction sites (e.g., DRY motif in TM3)

      • Dimerization interfaces

  • Chimeric proteins:

    • Create chimeras between S. canicula and mammalian rhodopsins to identify domains responsible for functional differences

    • Swap extracellular loops to investigate differences in activation kinetics

    • Exchange transmembrane domains to identify regions contributing to thermal stability

  • Structural biology techniques:

    • X-ray crystallography: requires large amounts of highly pure, stable protein

    • Cryo-EM: increasingly viable for membrane proteins including GPCRs

    • NMR spectroscopy: useful for investigating protein dynamics

  • Functional assays:

    • G-protein activation assays measuring GTPγS binding or cGMP levels

    • Calcium mobilization assays in transfected cells

    • Fluorescence-based conformational change assays

When designing mutagenesis experiments, researchers should consider both conservative and non-conservative substitutions. For example, to investigate the role of specific residues in spectral tuning, substitutions that introduce more polarizable side chains can test hypotheses about electrostatic interactions with the retinal chromophore.

How should I design my experiment to express and characterize recombinant Scyliorhinus canicula rhodopsin?

A comprehensive experimental design for expressing and characterizing recombinant S. canicula rhodopsin should include:

  • Construct Design:

    • Clone full-length S. canicula rhodopsin cDNA (rho gene)

    • Add appropriate affinity tags (C-terminal 1D4 tag or His-tag)

    • Include a fluorescent protein fusion (e.g., GFP) for localization studies

    • Generate multiple constructs with different promoters (CMV, EF1α)

  • Expression Optimization:

    • Test multiple cell lines (HEK293, COS-7, Sf9)

    • Optimize transfection conditions (reagent, DNA:reagent ratio)

    • Evaluate expression at different time points (24h, 48h, 72h)

    • Compare yields with and without sodium butyrate (5-10 mM) addition

  • Functional Characterization:

    • Spectral characterization (absorption maximum, extinction coefficient)

    • G-protein activation assays

    • Thermal stability measurements

    • pH sensitivity profiling

  • Controls to Include:

    • Empty vector negative control

    • Well-characterized bovine rhodopsin positive control

    • Multiple independent transfections for statistical validity

    • Appropriate blanks for spectroscopic measurements

  • Documentation and Analysis:

    • Detailed protocols for reproducibility

    • Statistical analysis of replicate experiments

    • Comparison with published data on other vertebrate rhodopsins

When conducting these experiments, it's crucial to work under dim red light conditions to prevent photobleaching of the purified rhodopsin. Additionally, all buffers should be degassed to minimize oxidation of the protein during purification and characterization.

What methods can be used to assess the interaction between Scyliorhinus canicula rhodopsin and G-proteins?

Several complementary methods can be employed to characterize the interaction between S. canicula rhodopsin and G-proteins:

  • GTPγS Binding Assay:

    • Measures nucleotide exchange on G-protein α subunit

    • Protocol:

      • Reconstitute purified rhodopsin in liposomes

      • Add purified G-protein heterotrimer (typically Gt)

      • Measure binding of [³⁵S]GTPγS before and after light activation

      • Quantify using liquid scintillation counting

  • BRET (Bioluminescence Resonance Energy Transfer):

    • Allows real-time monitoring of protein interactions in living cells

    • Requirements:

      • Tag rhodopsin with luciferase donor (e.g., Nanoluc)

      • Tag G-protein subunit with fluorescent acceptor (e.g., Venus)

      • Measure energy transfer before and after light stimulation

  • Fluorescence Spectroscopy:

    • Intrinsic tryptophan fluorescence changes upon G-protein binding

    • Enhanced by reconstituting rhodopsin with fluorescent retinal analogs

  • Surface Plasmon Resonance (SPR):

    • Provides kinetic parameters (kon, koff) and binding affinity

    • Implementation:

      • Immobilize rhodopsin on sensor chip

      • Flow G-protein at various concentrations

      • Compare dark state vs. light-activated state binding

  • Co-Immunoprecipitation:

    • Assess binding in cell lysates under physiological conditions

    • Western blot analysis for interacting proteins

When conducting these assays, researchers should consider the appropriate G-protein subtype. While mammalian rhodopsins typically couple to transducin (Gt), the specific G-protein coupling preferences of S. canicula rhodopsin should be experimentally determined, as they may differ from mammalian orthologs.

How can I investigate the thermal stability of recombinant Scyliorhinus canicula rhodopsin and its intermediates?

Investigating the thermal stability of S. canicula rhodopsin requires multiple complementary approaches:

  • Thermal Denaturation Assays:

    • UV-Visible Spectroscopy:

      • Monitor absorbance at λmax (~498 nm) during temperature ramp

      • Calculate half-life (t₁/₂) at various temperatures

      • Determine activation energy using Arrhenius plots

    • Differential Scanning Fluorimetry (DSF):

      • Use environmentally sensitive dyes (e.g., SYPRO Orange)

      • Measure fluorescence increase upon protein unfolding

      • Determine melting temperature (Tm)

  • Conformational Stability Analysis:

    • Circular Dichroism (CD) Spectroscopy:

      • Monitor secondary structure at increasing temperatures

      • Focus on 222 nm signal (α-helical content)

      • Compare with mammalian rhodopsins under identical conditions

  • Retinal Binding Pocket Stability:

    • Retinal Release Kinetics:

      • Monitor Schiff base hydrolysis at elevated temperatures

      • Measure absorbance decrease at λmax and increase at 380 nm

      • Calculate activation parameters (ΔH‡, ΔS‡, ΔG‡)

  • Meta-Intermediate Stability:

    • Flash Photolysis:

      • Generate photo-intermediates with brief light pulse

      • Monitor decay kinetics at various temperatures

      • Determine energy barriers between intermediates

  • Protease Resistance:

    • Limited Proteolysis:

      • Incubate rhodopsin with trypsin or proteinase K

      • Compare digestion patterns at different temperatures

      • Analyze fragments by SDS-PAGE or mass spectrometry

Data collection should include measurements at multiple temperatures (typically 5°C to 55°C in 5°C increments) with appropriate equilibration times at each temperature. For accurate comparison with mammalian rhodopsins, all proteins should be studied under identical buffer conditions, preferably in a system that mimics the native membrane environment (e.g., nanodiscs or liposomes).

What are common challenges in recombinant expression of Scyliorhinus canicula rhodopsin and how can they be addressed?

Researchers often encounter several challenges when expressing recombinant S. canicula rhodopsin:

ChallengePotential CausesSolutions
Low expression levelsSuboptimal codon usage, toxic to host cellsCodon optimization, use of inducible promoters, lower expression temperature (28-30°C)
Misfolding/aggregationOverwhelming cellular folding machineryCo-express chaperones (e.g., BiP, calnexin), add chemical chaperones (e.g., 4-PBA, DMSO), use Pichia pastoris
Poor chromophore incorporationLimited 11-cis retinal availability, improper protein foldingAdd excess retinal during purification, ensure dark conditions, try 9-cis retinal as alternative
Protein instabilityDetergent-induced denaturationScreen multiple detergents (DDM, LMNG, GDN), add stabilizers (cholesterol hemisuccinate)
Low functional activityImproper disulfide bond formationInclude reducing agents during solubilization, then oxidize for proper disulfide formation

When facing expression challenges, a systematic approach is recommended:

  • First optimize at the DNA level (codon usage, signal sequences)

  • Then address protein production (cell type, culture conditions)

  • Finally focus on protein quality (folding aids, stabilizers)

For particularly difficult constructs, consider fusion partners that enhance expression and folding, such as maltose-binding protein (MBP) or thioredoxin, with a cleavable linker to remove the fusion partner after purification.

How can I troubleshoot spectroscopic abnormalities in my recombinant Scyliorhinus canicula rhodopsin preparations?

Spectroscopic abnormalities in recombinant rhodopsin preparations can indicate various issues with protein quality. Here's a systematic approach to diagnose and address common problems:

  • Abnormally low A280/A500 ratio (ideal ratio ~1.6-1.8):

    • High ratio (>2.5): Indicates poor chromophore incorporation

      • Solution: Ensure dark conditions, add fresh 11-cis retinal, extend incubation time

    • Low ratio (<1.5): May indicate sample contamination

      • Solution: Additional purification steps, particularly size exclusion chromatography

  • Blue-shifted absorption maximum:

    • Potential causes: Altered retinal binding pocket, protonation state changes

    • Diagnostic approach:

      • Measure at multiple pH values (pH 6.0, 7.4, 8.0)

      • Compare with acid or hydroxylamine denaturation spectra

    • Solution: Check buffer composition, especially counterions and salt concentration

  • Rapid photobleaching without characteristic intermediates:

    • Indicates structural instability around retinal binding pocket

    • Solution:

      • Optimize buffer conditions (add zinc or calcium ions)

      • Reduce detergent concentration to minimum required for solubility

      • Try bicelle or nanodisc reconstitution to provide lipid environment

  • Unable to detect Meta II intermediate:

    • Check instrumentation time resolution (Meta II forms within milliseconds)

    • Ensure complete photoactivation (use >495 nm filter, sufficient light intensity)

    • Test G-protein interaction to confirm functionality despite spectroscopic issues

  • Unusual spectral shoulders or additional peaks:

    • May indicate presence of other retinal isomers or degradation products

    • Solution: HPLC purification of retinal before reconstitution, minimize light exposure

When troubleshooting, always include well-characterized control samples (e.g., bovine rhodopsin) processed in parallel to distinguish protein-specific issues from technical problems with instruments or reagents.

How should I analyze and interpret spectral data from Scyliorhinus canicula rhodopsin experiments?

Proper analysis of spectral data from S. canicula rhodopsin requires careful consideration of several factors:

  • Absorption Spectrum Analysis:

    • Baseline correction: Subtract spectrum of buffer with matching detergent concentration

    • Scattering correction: Apply either:

      • Mathematical correction based on λ⁻⁴ dependence of Rayleigh scattering

      • Empirical correction using data points at wavelengths >650 nm

    • Peak identification:

      • Main peak (~498 nm): Properly folded rhodopsin

      • 280 nm peak: Protein concentration (includes non-rhodopsin proteins)

      • 380 nm peak: Free retinal or denatured rhodopsin

  • Quantitative Analysis:

    • Concentration determination:

      • Use extinction coefficient (ε) at λmax (~40,600 M⁻¹cm⁻¹)

      • Calculate molar concentration using Beer-Lambert law: A = εcl

    • Purity assessment:

      • Calculate A280/Aλmax ratio (ideal value ~1.6-1.8)

      • Higher ratios indicate lower chromophore incorporation

  • Photobleaching Analysis:

    • Calculate difference spectra (dark-light)

    • Identify spectral intermediates:

      • Meta I (~480 nm)

      • Meta II (~380 nm)

    • Determine isosbestic points (wavelengths where absorbance doesn't change)

    • Quantify photobleaching efficiency (% of rhodopsin converted to Meta II)

  • Kinetic Data Analysis:

    • Fit exponential functions to time-course data:

      • Single exponential: y = y₀ + A·e⁻ᵏᵗ

      • Multi-exponential: y = y₀ + A₁·e⁻ᵏ¹ᵗ + A₂·e⁻ᵏ²ᵗ + ...

    • Extract rate constants (k) and half-lives (t₁/₂ = ln(2)/k)

    • Compare with published values for other rhodopsins

When publishing spectral data, always include:

  • Complete experimental conditions (buffer, pH, temperature, detergent)

  • Raw spectral data as well as processed/normalized data

  • Statistical analysis across multiple independent preparations

  • Comparison with appropriate controls (e.g., bovine rhodopsin)

What advanced analytical techniques can be applied to study the structural dynamics of Scyliorhinus canicula rhodopsin?

Several advanced biophysical techniques provide insights into the structural dynamics of rhodopsin:

When applying these techniques to S. canicula rhodopsin, researchers should consider the specific adaptations that might distinguish shark rhodopsin from mammalian counterparts, such as potential differences in conformational flexibility that contribute to enhanced thermal stability or altered photochemical properties.

How does recombinant Scyliorhinus canicula rhodopsin compare to other shark rhodopsins in structure and function?

Comparative analysis of shark rhodopsins reveals both conservation and specialization:

SpeciesAbsorption MaximumG-protein Activation EfficiencyThermal StabilityNotable Adaptations
Scyliorhinus canicula (Small-spotted catshark)496-499 nmModerateHighDeep-water adaptation
Squalus acanthias (Spiny dogfish)494-496 nmHighModerateVariable depth habitat
Carcharodon carcharias (Great white shark)494-497 nmHighModerateVisual predator
Rhincodon typus (Whale shark)488-492 nmLowVery highFilter feeder, deep diving

The S. canicula rhodopsin represents a typical shark visual pigment, with adaptations that reflect its ecological niche. Several key differences from other shark rhodopsins include:

  • Sequence variations:

    • Specific amino acid substitutions in transmembrane domains

    • Unique residues in the retinal binding pocket that fine-tune spectral sensitivity

    • Modifications in G-protein interaction domains that affect signaling efficiency

  • Functional differences:

    • Slightly red-shifted absorption maximum compared to some deep-sea sharks

    • Enhanced thermal stability compared to shallow-water species

    • Different photobleaching kinetics reflecting habitat light conditions

  • Phylogenetic significance:

    • Positioned as an important comparative model between ancestral and derived forms

    • Represents conserved features of the ancestral jawed vertebrate rhodopsin

When conducting comparative studies, researchers should consider using consistent expression systems and analytical methods to minimize technical variations that could mask genuine biological differences between species.

What insight can studies of Scyliorhinus canicula rhodopsin provide about visual adaptation in vertebrates?

Studies of S. canicula rhodopsin offer several unique insights into vertebrate visual evolution:

  • Evolutionary Conservation and Divergence:

    • The rhodopsin gene (rho) in S. canicula represents an important evolutionary reference point

    • Comparative analysis reveals:

      • Core functional residues conserved across 400+ million years of evolution

      • Lineage-specific adaptations in extracellular domains

      • Insight into ancestral vertebrate rhodopsin properties

  • Simplified Visual System as a Model:

    • S. canicula has lost several visual opsins common in other vertebrates:

      • No SWS genes (lost in all chondrichthyans)

      • No LWS/MWS genes (retained in some other shark species)

    • This simplification offers a "natural knockout" model to study:

      • Rhodopsin-specific visual processing

      • Adaptation to monochromatic vision

      • Compensation mechanisms for limited spectral sensitivity

  • Environmental Adaptation Mechanisms:

    • Spectral tuning adaptations to marine environments:

      • Fine-tuned absorption maximum for deep water light penetration

      • Enhanced thermal stability for deep, cold water conditions

    • Signal transduction optimizations:

      • Specific G-protein coupling properties

      • Altered photoactivation and deactivation kinetics

  • Developmental Insights:

    • Transient expression of rh2 opsin in embryonic but not adult retina

    • This pattern suggests:

      • Developmental role for multiple opsins even in species that use only rhodopsin as adults

      • Potential recapitulation of ancestral expression patterns during development

      • Insight into regulatory mechanisms controlling opsin expression

Research on S. canicula rhodopsin contributes to understanding fundamental principles of sensory protein evolution and adaptation, particularly how molecular changes correlate with ecological specialization and environmental pressures.

What emerging technologies might advance our understanding of Scyliorhinus canicula rhodopsin?

Several cutting-edge technologies show promise for advancing research on shark rhodopsin:

  • Cryo-EM for Membrane Protein Structural Biology:

    • Recent advances enable:

      • Near-atomic resolution of GPCRs without crystallization

      • Visualization of conformational heterogeneity

      • Structure determination in lipid environments

    • Applications for S. canicula rhodopsin:

      • Determination of active and inactive state structures

      • Comparison with mammalian rhodopsin structures

      • Visualization of rhodopsin dimers/oligomers in native-like membranes

  • Artificial Intelligence for Structural Prediction:

    • Tools like AlphaFold2 and RoseTTAFold can:

      • Predict structures of rhodopsin variants

      • Model protein-protein interactions

      • Guide rational design of mutations

    • Potential to accelerate structure-function studies by prioritizing experiments

  • Optogenetic Applications:

    • Engineering chimeric proteins combining:

      • Stability of shark rhodopsin

      • Signaling domains from other GPCRs

    • Creating novel optogenetic tools with enhanced properties:

      • Greater thermal stability

      • Altered spectral sensitivity

      • Modified activation kinetics

  • Single-Molecule Techniques:

    • Methods such as:

      • Single-molecule FRET

      • Total internal reflection fluorescence (TIRF) microscopy

      • Atomic force microscopy (AFM)

    • Reveal:

      • Conformational dynamics at unprecedented resolution

      • Rare or transient states

      • Heterogeneity in molecular behavior

  • In Situ Structural Biology:

    • Techniques like:

      • Cryo-electron tomography

      • Correlative light and electron microscopy

    • Enable:

      • Visualization of rhodopsin in cellular context

      • Native organization in rod outer segments

      • Interaction with other components of the visual cascade

These technologies will help address outstanding questions about the molecular basis of shark rhodopsin's unique properties and potentially lead to applications in biomedical research and biotechnology.

What unresolved questions remain about the molecular basis of Scyliorhinus canicula rhodopsin function?

Despite advances in understanding S. canicula rhodopsin, several key questions remain unresolved:

  • Structural Basis of Enhanced Stability:

    • Which specific amino acid substitutions contribute to the enhanced thermal stability?

    • How do these residues interact to stabilize the protein structure?

    • What role do specific lipid interactions play in stability?

  • G-Protein Coupling Specificity:

    • What is the precise G-protein coupling preference of S. canicula rhodopsin?

    • Does it interact efficiently with mammalian transducin?

    • Are there shark-specific adaptations in G-protein interaction domains?

  • Oligomerization Properties:

    • Does S. canicula rhodopsin form dimers or higher-order oligomers?

    • What is the functional significance of any oligomeric structures?

    • How does oligomerization impact signaling efficiency?

  • Chromophore-Protein Interactions:

    • What specific interactions fine-tune the spectral properties?

    • How does the protein environment impact the photochemistry of retinal isomerization?

    • Are there differences in the hydrogen-bonding network around the Schiff base?

  • Regulatory Mechanisms:

    • What controls the exclusive expression of rhodopsin in adult shark retina?

    • What regulatory elements govern the developmental switch from rh2 to rho dominance?

    • How is rhodopsin expression coordinated with expression of downstream signaling components?

  • Functional Consequences of Simplified Opsin Repertoire:

    • How does the loss of cone opsins impact visual capabilities in sharks?

    • What compensatory mechanisms enhance rod-mediated vision?

    • What are the molecular adaptations in downstream signaling proteins?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular biology, and comparative genomics. The answers will not only enhance our understanding of shark vision but also provide broader insights into sensory protein evolution and adaptation.

What key considerations should researchers keep in mind when working with recombinant Scyliorhinus canicula rhodopsin?

When working with recombinant S. canicula rhodopsin, researchers should consider several critical factors to ensure successful experiments:

  • Technical Considerations:

    • Light sensitivity: Conduct all experiments under dim red light to prevent unintended photoactivation

    • Temperature control: Maintain consistent temperature during purification and analysis

    • Detergent selection: Choose detergents carefully to maintain native-like structure

    • Sample handling: Minimize freeze-thaw cycles and exposure to oxidizing conditions

    • Time management: Plan experiments to account for the protein's limited stability once purified

  • Experimental Design Considerations:

    • Include appropriate controls (positive, negative, and procedural)

    • Validate key findings using multiple orthogonal techniques

    • Consider species-specific adaptations when interpreting results

    • Design experiments that leverage the unique properties of shark rhodopsin

    • Account for potential differences between recombinant and native protein

  • Comparative Context:

    • Compare with well-characterized mammalian rhodopsins

    • Consider evolutionary relationships when interpreting differences

    • Place findings in ecological context of the species' visual environment

    • Use phylogenetic approaches to distinguish ancestral from derived features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.