Recombinant Scyliorhinus torazame L-gulonolactone oxidase (GULO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GULO; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Scyliorhinus torazame (Cloudy catshark)
Target Names
GULO
Target Protein Sequence
MDQGTMGYQFENWATTYSCEPELYFEPTTVEEIRQILELANQRNKRVKVVGCGHSPSDIA CTDNYLVRLNKLNRILQVDKERKWITAEAGILLSDLNEKLDALGLALSNIGAVSDVALGG VIGTGTHNTGIQHGILATQIVAMTLMTAAGDTLECSNTVNREIFQATRLHLGSLGVVLNV TIQCVPAFRIHLQQFPKTLTEVLGDLDTHLKQSEYFRFFWFPHTDKVTVFYADRTNKPIK TTSSWFWNYAIGYYLLEFLLWISVFVPRLVPWINRLFYWLLYSAKAEQVKRSDKAFNFDC LFKQHVSDWALPIKQTRAALEQLKDWLDNNPNVRAHFPVEVRFVRADDILLSPCYRQDSC YINIIMYRPYGKEVPREGYWAMYEEIMKRNGGRPHWAKAHSLLRQDFEKIYPAFHKFCSI REELDPSGMFLNNYLEKTFF
Uniprot No.

Target Background

Function
Oxidizes L-gulono-1,4-lactone to hydrogen peroxide and L-xylo-hexulonolactone, which spontaneously isomerizes to L-ascorbate.
Protein Families
Oxygen-dependent FAD-linked oxidoreductase family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is L-gulonolactone oxidase (GULO) and why is the Scyliorhinus torazame version significant?

L-gulonolactone oxidase (GULO) is the terminal enzyme in the ascorbic acid (vitamin C) biosynthesis pathway, catalyzing the oxidation of L-gulonolactone into ascorbic acid. The Scyliorhinus torazame (cloudy catshark) GULO is particularly significant because it represents a functional version of the enzyme that can be used in recombinant studies to restore vitamin C synthesis capabilities in organisms that have lost this ability.

Many vertebrate species, including teleost fish (like zebrafish and Nile tilapia), anthropoid primates, guinea pigs, certain bat species, and passerine birds, have lost the ability to synthesize vitamin C due to the absence of a functional GULO gene . The cloudy catshark retains this enzyme, making it an ideal source for recombinant studies aimed at reestablishing vitamin C synthesis in other species .

How is the GULO enzyme structurally characterized and what makes it functionally active?

The GULO enzyme belongs to the family of aldonolactone oxidoreductases (AlORs) and contains two conserved domains:

  • An N-terminal FAD-binding region

  • A C-terminal HWXK motif capable of binding the flavin cofactor

The enzyme requires FAD as a cofactor, which can be either covalently or non-covalently bound depending on the species. The binding of the flavin cofactor to the HWXK motif at the C-terminus is crucial for the formation of the enzyme's active site . The complete amino acid sequence of Scyliorhinus torazame GULO consists of 440 amino acids, as shown in the database entry from colorectal research .

Bioinformatics analyses, including homology modeling and multiple sequence alignments of GULO and gluconolactonase, have been conducted to better understand the structural properties of this enzyme .

What cloning strategies have been most successful for creating recombinant Scyliorhinus torazame GULO systems?

The Gateway cloning method has proven highly effective for creating recombinant systems expressing Scyliorhinus torazame GULO. In studies with zebrafish, researchers constructed recombinant expression vectors using the following approach:

  • Isolation of the GULO gene (sGULO) from cloudy catshark kidneys

  • Construction of entry clones using BP recombination reaction with attB-cloning sequences

  • Development of expression clones combining the b-actin promoter, sGULO ORF, and mCherry reporter gene using LR recombination reactions

For bacterial systems, such as probiotic Bacillus subtilis, researchers have successfully integrated the GULO-encoding gene into the bacterial chromosome through recombinant technology .

How can researchers verify successful expression and activity of recombinant GULO in transgenic models?

Verification of successful expression and activity involves multiple complementary approaches:

  • Genetic confirmation:

    • PCR analysis of genomic DNA to confirm integration

    • qRT-PCR to measure GULO mRNA expression levels in target tissues

  • Protein expression verification:

    • Fluorescent microscopy (when using reporter genes like mCherry)

    • Western blot analysis with specific antibodies

  • Functional verification:

    • GULO enzyme activity assay (modified method from Ayaz et al., 1976)

    • Quantification of ascorbic acid levels using HPLC

    • Measurement of physiological effects (growth parameters, antioxidant markers)

A standard GULO activity assessment involves incubating tissue homogenates with L-gulonolactone substrate, followed by spectrophotometric detection at 524 nm using a standardized ascorbic acid curve for reference .

What growth performance improvements have been documented in organisms expressing recombinant GULO?

Studies have documented significant growth improvements in organisms expressing recombinant GULO. In Nile tilapia fed with recombinant B. subtilis expressing GULO (BS+GULO) for 90 days, researchers observed:

  • Increased final weight

  • Enhanced weight gain

  • Improved specific growth rate

  • Higher average daily gain

  • Better relative growth rate compared to control groups

Similar growth enhancements were observed in transgenic zebrafish expressing sGULO. The transgenic fish showed increased growth compared to wild-type fish when both were maintained under identical conditions and fed the same diet .

How does recombinant GULO expression influence immune function and antioxidant activity?

Recombinant GULO expression significantly enhances both immune function and antioxidant activity:

Immune parameters improved in Nile tilapia fed with BS+GULO:

  • Increased alternative complement 50 (ACH50) levels

  • Elevated total immunoglobulin (Ig) levels

  • Enhanced lysozyme activity

  • Improved phagocytic activity

  • Upregulated pro-inflammatory gene expression (CC chemokine, TNFα) following pathogen challenge

Antioxidant parameters enhanced in organisms with recombinant GULO expression:

ParameterControl (CON)Vitamin C (VC)Wild-type B. subtilis (BS)Recombinant B. subtilis (BS+GULO)
Total Antioxidant Capacity (TAC) (µmol mL⁻¹)28.16 ± 0.91ᵃ38.85 ± 1.32ᵇ32.03 ± 1.02ᵃᵇ36.01 ± 1.78ᵇ
Superoxide Dismutase (SOD) (U mL⁻¹)3.32 ± 0.10ᵃ4.34 ± 0.34ᵇ4.04 ± 0.12ᵃᵇ4.69 ± 0.32ᵇ
Malondialdehyde (MDA) (nmol mL⁻¹)0.36 ± 0.006ᶜ0.23 ± 0.025ᵃ0.31 ± 0.002ᵇ0.28 ± 0.006ᵇ
Glutathione Peroxidase (GSH-Px) (U mL⁻¹)0.068 ± 0.001ᵃ0.121 ± 0.013ᵇ0.088 ± 0.007ᵃᵇ0.117 ± 0.016ᵇ
Catalase (CAT) (nmol min⁻¹ mL⁻¹)10.39 ± 0.83ᵃ31.27 ± 2.59ᶜ17.29 ± 1.32ᵃᵇ20.34 ± 4.16ᵇ

Note: Values with different superscripts in each row differ significantly (p < 0.05)

What are the optimal methods for measuring GULO enzyme activity in recombinant systems?

The standard GULO activity assessment protocol involves the following steps:

  • Sample preparation:

    • Homogenization of tissue samples in buffer (typically phosphate buffer)

    • Centrifugation to obtain supernatant (4 mL)

  • Enzymatic reaction:

    • Addition of 5.6 mM L-gulonolactone substrate

    • Incubation at 25°C for 30 minutes under normal atmospheric conditions

  • Reaction termination:

    • Addition of stopping solution (18% metaphosphoric acid and 16% trichloroacetic acid)

    • Addition of acid-washed charcoal and filtration

  • Color development:

    • Addition of 2,4-Dinitrophenylhydrazine reagent to the filtrate

    • Incubation at 47°C for 90 minutes

    • Cooling in an ice bath with dropwise addition of 85% H₂SO₄

  • Measurement:

    • Measurement of absorbance at 524 nm

    • Calculation of activity using an ascorbic acid standard curve

For optimal results, it's recommended to include appropriate wild-type samples as blanks and to prepare a fresh ascorbic acid standard curve for each assay batch.

How should feeding trials be designed when testing recombinant GULO-expressing probiotics?

Effective feeding trial design for testing recombinant GULO-expressing probiotics should include:

  • Experimental groups:

    • Control group (basal diet without supplements) - CON

    • Positive control (basal diet + vitamin C) - VC

    • Wild-type probiotic group (basal diet + wild-type probiotic) - BS

    • Recombinant probiotic group (basal diet + recombinant probiotic expressing GULO) - BS+GULO

  • Feed preparation:

    • Careful mixing of ingredients according to nutritional requirements

    • Pelleting using industrial equipment

    • Proper storage at -20°C

    • Manual grinding before feeding

  • Trial duration:

    • Long-term trials (90 days) for comprehensive evaluation

    • Sampling at multiple time points (e.g., day 30, day 90) to monitor progression

  • Data collection:

    • Growth parameters (weight, length, specific growth rate)

    • Blood sampling for immune and antioxidant parameters

    • Tissue sampling for gene expression analysis

    • Challenge tests with pathogens to assess disease resistance

What molecular mechanisms underlie the enhanced immune response observed in organisms with recombinant GULO expression?

The enhanced immune response in organisms expressing recombinant GULO appears to involve multiple molecular mechanisms:

  • Increased vitamin C availability:

    • Higher vitamin C concentrations in leukocytes and tissues stimulate innate immune response activities

    • Vitamin C acts as a cofactor for various enzymes involved in immune function

  • Probiotic signaling pathways:

    • When using probiotic carriers (like B. subtilis), toll-like receptors (TLRs) on intestinal epithelial cells and antigen-presenting cells (APCs) are activated

    • This activation initiates immune system signaling cascades

  • Pro-inflammatory cytokine regulation:

    • Recombinant GULO expression leads to rapid and significant upregulation of pro-inflammatory genes, including:

      • CC chemokine (peaks at 12h in liver and spleen)

      • TNFα (significant increase at 6h in liver, persisting until 48h)

    • This cytokine regulation enhances pathogen recognition and neutralization

  • Complement system activation:

    • Rapid increase in ACH50 levels at 6h post-pathogen challenge indicates enhanced ability to attenuate/limit pathogen spread

    • This is followed by elevated total Ig levels at 24-48h, suggesting effective transition to adaptive immune responses

What are the challenges in optimizing recombinant GULO expression for maximum enzymatic activity?

Several challenges exist in optimizing recombinant GULO expression for maximum enzymatic activity:

  • Correct folding and cofactor binding:

    • GULO requires proper FAD cofactor binding for activity

    • In bacterial expression systems like E. coli, recombinant GULO is often produced in apo form (lacking the flavin cofactor)

    • The enzyme requires either non-covalent binding of externally added FAD or covalent FAD attachment

  • Expression system selection:

    • Insect cells using baculovirus systems can produce both holo and apo forms depending on media riboflavin content

    • Bacterial systems often produce improperly folded proteins

    • The choice between prokaryotic and eukaryotic expression systems significantly impacts enzyme functionality

  • Signal peptide optimization:

    • For secreted expression, signal peptide selection is crucial

    • Further research is needed to improve signal peptides for enhanced recombinant GULO protein expression

  • Subcellular localization:

    • In natural systems, GULO is localized to specific subcellular compartments (e.g., endoplasmic reticulum in animals)

    • Correct targeting in recombinant systems may be necessary for optimal activity

Future research should focus on addressing these challenges to improve recombinant GULO expression and activity for both research and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.