Recombinant Sebaldella termitidis Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate your requirement when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Kindly consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, serving as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development accordingly.
Synonyms
secF; Sterm_2737; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Sebaldella termitidis (strain ATCC 33386 / NCTC 11300)
Target Names
secF
Target Protein Sequence
MDLKLMKTRNVYFIFSTFMILFSLFSIFTKGFNLGIDFTGGNIYQMKFEKPVSKEAMDKT LKEMASKYPSLKSNKVQYSEGNTVLLRTQIADEKEKSAILEELKAEQGNYELIKADAVGA VVGNELAKNALWALALGSILILIYITIRFEWIYALSSVLALLHDVLVTIGFISFFQFEVD TPFIAAILTILGYSMNDTIVIFDRIRENDHKYGGKKPFADVIDESVNKVFIRSVYTSLTT LLALAALLIFGGSTLRTFNITLLVGIVYGTYSSIWLASPLVYLLRRFKKPPKQEKNGKKD RSMEKVVV
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sebaldella termitidis and why is its SecF protein of interest?

Sebaldella termitidis (Sebald 1962) Collins and Shah 1986 is a unique bacterial species within the fusobacterial family 'Leptotrichiaceae'. As the sole species in the genus Sebaldella, it was first isolated approximately 50 years ago from intestinal content of Mediterranean termites. The organism holds particular scientific interest due to its isolated phylogenetic position within the Fusobacteria phylum, with no other species sharing more than 90% 16S rRNA sequence similarity . The complete genome sequence of S. termitidis consists of 4,486,650 bp with 4,210 protein-coding and 54 RNA genes . Within this genome, the SecF protein functions as part of the essential bacterial protein translocation machinery, making it valuable for comparative studies of bacterial secretion systems across evolutionary diverse species.

How does SecF function within the bacterial protein translocation system?

SecF operates as part of the SecDF complex that works in conjunction with the SecYEG preprotein conducting channel. While the search results don't provide detailed information specifically about SecF's function, we can derive understanding from information about the related SecD protein. The SecDF complex utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA . SecF plays an essential role in this process by helping maintain the proper conformation of translocating proteins and preventing their backsliding through the SecYEG channel. This function is crucial for efficient translocation of secretory proteins across the bacterial cytoplasmic membrane, especially those with complex folding requirements or those that may fold slowly after translocation.

What experimental approaches enable functional characterization of recombinant SecF?

Functional characterization of recombinant SecF typically employs a multi-faceted approach:

  • In vitro translocation assays: Reconstitution of the Sec system components (SecYEG, SecA, SecDF) in liposomes with fluorescently-labeled preproteins to measure translocation efficiency. The proton motive force can be simulated using pH gradients across the membrane.

  • Site-directed mutagenesis: Creating specific mutations in conserved residues of SecF to identify functional domains and critical amino acids. This approach helps map regions involved in interactions with other Sec components or those essential for utilizing the proton motive force.

  • Protein-protein interaction studies: Techniques such as bacterial two-hybrid systems, surface plasmon resonance, or co-immunoprecipitation can be used to investigate SecF interactions with SecD, SecYEG, and other potential partners.

  • Structural studies: While challenging due to the membrane nature of SecF, cryo-electron microscopy or X-ray crystallography of the purified recombinant protein can provide insights into its three-dimensional structure and conformational changes during the translocation cycle.

These methodologies require high-quality, properly folded recombinant SecF, which can be produced using the commercially available preparations described in the search results .

How do storage conditions affect stability and activity of recombinant SecF preparations?

The stability and activity of recombinant SecF are significantly influenced by storage conditions, as indicated by product specifications from suppliers. For optimal preservation:

  • Temperature requirements: Store recombinant SecF at -20°C for regular storage, with -80°C recommended for extended preservation. Working aliquots can be maintained at 4°C for up to one week, but not longer .

  • Freeze-thaw sensitivity: Repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and activity loss. Creating single-use aliquots before freezing is strongly recommended .

  • Buffer optimization: The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for stability. This high glycerol concentration acts as a cryoprotectant to prevent ice crystal formation during freezing .

  • Shelf life considerations: Liquid formulations typically maintain activity for approximately 6 months when stored at -20°C/-80°C, while lyophilized preparations can remain stable for up to 12 months under the same conditions. The stability is affected by multiple factors including buffer ingredients and the intrinsic properties of the protein itself .

  • Reconstitution protocol: For lyophilized preparations, proper reconstitution is critical. Brief centrifugation of the vial before opening is recommended to collect all material at the bottom. Reconstitution should use deionized sterile water to achieve a final concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (typically 50%) for subsequent storage .

These storage guidelines are essential for maintaining the structural integrity and functional activity of recombinant SecF in research applications.

What are the challenges in studying SecF-SecD interactions and how can they be overcome?

Studying SecF-SecD interactions presents several methodological challenges:

  • Membrane protein complexes: Both SecF and SecD are integral membrane proteins, making them difficult to study in isolation while maintaining native conformations. Researchers can overcome this by using specialized detergent systems or nanodiscs that mimic the lipid bilayer environment.

  • Dynamic interactions: The SecF-SecD interaction is likely dynamic and dependent on proton motive force, making it challenging to capture all relevant conformational states. Time-resolved biophysical techniques may help elucidate these transient states.

  • Functional reconstitution: Reconstituting functional SecDF complexes requires specific lipid compositions and proper membrane insertion. Optimized proteoliposome systems with defined lipid compositions can help address this challenge.

  • Distinguishing individual contributions: Separating the individual contributions of SecF and SecD to protein translocation is difficult since they typically function together. Complementation studies with chimeric or mutant proteins can help delineate their specific roles.

Based on related research on bacterial translocase systems, approaches such as site-specific crosslinking, FRET (Förster Resonance Energy Transfer) analysis, and native mass spectrometry have proven valuable for characterizing membrane protein complexes like SecDF. The availability of recombinant SecF and SecD from S. termitidis (D1AMK8 and D1AMK9, respectively) facilitates these specialized interaction studies .

What expression systems are optimal for producing functional recombinant SecF?

The optimal expression systems for producing functional recombinant SecF depend on research requirements for yield, folding, and post-translational modifications:

  • Mammalian cell expression systems: The search results indicate that commercial recombinant SecF from S. termitidis is produced in mammalian cell systems . This approach offers advantages for complex membrane proteins by providing eukaryotic chaperones and membrane insertion machinery that may facilitate proper folding.

  • E. coli expression systems: For the related SecD protein, E. coli is used as an expression host . This system offers high yield and cost-effectiveness but may require optimization for membrane proteins through strategies such as:

    • Using specialized E. coli strains (C41, C43) designed for membrane protein expression

    • Employing fusion tags that enhance solubility or membrane targeting

    • Controlling expression rates through temperature reduction and inducer concentration optimization

  • Expression considerations: Regardless of the chosen system, several factors require optimization:

    • Codon optimization for the expression host

    • Signal sequence selection for membrane targeting

    • Induction conditions (temperature, time, inducer concentration)

    • Membrane extraction methods that preserve protein structure and function

For research applications requiring larger quantities or specialized modifications of SecF, custom expression protocols may need development based on the foundation of these commercial production methods.

What purification strategies yield high-purity recombinant SecF suitable for structural and functional studies?

Effective purification of recombinant SecF requires a multi-step strategy that maintains protein structure while achieving high purity:

  • Initial extraction: Membrane proteins like SecF require careful extraction from cellular membranes using appropriate detergents. Commonly used detergents include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin at concentrations optimized to solubilize the protein without denaturation.

  • Affinity chromatography: The recombinant SecF products described in the search results include tags (though the specific tag type is determined during the production process) . These tags facilitate initial purification through affinity chromatography:

    • His-tags allow purification using nickel or cobalt affinity resins

    • GST-tags enable purification on glutathione agarose

    • FLAG or Strep tags provide alternatives for gentle elution conditions

  • Secondary purification: Following affinity purification, size exclusion chromatography (SEC) helps separate SecF from aggregates and other contaminants while maintaining it in a native-like state. For higher resolution, ion exchange chromatography may be employed as an intermediate step.

  • Quality assessment: Purified SecF should undergo quality control through:

    • SDS-PAGE analysis to confirm >85% purity, as specified for commercial products

    • Circular dichroism to verify secondary structure

    • Dynamic light scattering to assess homogeneity

    • Activity assays to confirm functional integrity

  • Buffer optimization: Final formulation in appropriate buffers containing stabilizing agents is critical. The commercial preparations use Tris-based buffers with 50% glycerol , which provides stability during storage while maintaining compatibility with downstream applications.

These purification approaches yield SecF preparations suitable for both functional studies and structural analyses, including crystallization trials or cryo-electron microscopy.

What analytical methods can assess the quality and activity of purified recombinant SecF?

Multiple analytical methods can verify the quality and functional activity of purified recombinant SecF:

  • Purity and integrity assessment:

    • SDS-PAGE with Coomassie or silver staining to verify the expected molecular weight (the full-length S. termitidis SecF consists of 308 amino acids)

    • Western blotting using tag-specific or SecF-specific antibodies

    • Mass spectrometry to confirm protein identity and detect potential modifications or degradation

    • Size exclusion chromatography to assess oligomeric state and aggregation

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to analyze secondary structure content

    • Fluorescence spectroscopy to examine tertiary structure through intrinsic tryptophan fluorescence

    • Thermal shift assays to determine protein stability under various conditions

    • Limited proteolysis to verify proper folding (well-folded membrane proteins show characteristic protease-resistant fragments)

  • Functional activity assays:

    • Reconstitution into liposomes to test proton translocation activity

    • ATPase stimulation assays to measure interaction with SecA

    • Protein translocation assays using fluorescently labeled model substrates

    • Binding assays to measure interactions with other Sec components using surface plasmon resonance or microscale thermophoresis

  • Membrane insertion analysis:

    • Proteoliposome flotation assays to confirm proper membrane integration

    • Protease protection assays to verify correct topology

    • Electron microscopy of reconstituted SecF in nanodiscs or liposomes

The commercial recombinant SecF specifications indicate purity levels of >85% by SDS-PAGE analysis , providing a benchmark for laboratory-produced preparations. For specific functional studies, developing activity assays tailored to the research question is essential, as standard activity metrics may not be directly applicable to all experimental contexts.

How can recombinant SecF be used to investigate bacterial protein secretion mechanisms?

Recombinant SecF enables multiple research approaches to illuminate bacterial protein secretion mechanisms:

These applications collectively expand our understanding of the fundamental processes underlying bacterial protein secretion while potentially yielding practical applications in medicine and biotechnology.

What experimental designs can investigate the relationship between SecF structure and function?

Investigating structure-function relationships in SecF requires complementary experimental approaches:

  • Targeted mutagenesis strategy:

    • Alanine-scanning mutagenesis of conserved residues or domains

    • Mutation of predicted transmembrane regions to alter membrane topology

    • Creation of chimeric proteins combining domains from different species

    • Introduction of cysteine pairs for disulfide crosslinking studies of conformational changes

  • Biophysical characterization:

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Single-molecule FRET to monitor conformational changes during the translocation cycle

    • Cryo-electron microscopy of SecDF alone or in complex with SecYEG

    • Solid-state NMR to examine specific interactions in the membrane environment

  • Computational approaches:

    • Molecular dynamics simulations of SecF in lipid bilayers

    • Homology modeling based on related structures

    • Evolutionary coupling analysis to identify co-evolving residues likely to be functionally linked

  • Functional correlation:

    • In vitro translocation assays with wild-type and mutant SecF

    • Proton transport measurements using pH-sensitive fluorescent dyes

    • Genetic complementation studies in SecF-depleted bacterial strains

These methodologies can utilize the commercially available recombinant SecF as control material or starting point , with studies designed to systematically explore how specific structural elements contribute to the protein's function in the translocation process.

What are the most promising research directions for SecF studies?

The study of Sebaldella termitidis SecF opens several promising research avenues:

  • Structural biology: Determining high-resolution structures of SecF and the SecDF complex would significantly advance understanding of the translocation mechanism. Recent advances in cryo-electron microscopy and membrane protein crystallization techniques make this increasingly feasible.

  • Dynamics and energetics: Investigating how SecF harnesses the proton motive force to drive protein translocation remains a fundamental question. Real-time monitoring of SecF conformational changes coupled with proton movement would provide valuable insights into this energy transduction mechanism.

  • Species-specific adaptations: Comparative studies between S. termitidis SecF and homologs from other bacteria could reveal adaptations related to the organism's unique ecological niche in termite intestines, potentially uncovering novel functional aspects of the protein.

  • Systems biology approach: Integrating SecF studies with comprehensive analysis of the S. termitidis proteome and secretome would contextualize its role in the organism's physiology and ecological interactions.

  • Antimicrobial development: As a component of the essential Sec machinery, SecF represents a potential target for novel antibiotics. Structure-based drug design approaches targeting SecF or the SecDF complex could yield new antimicrobial strategies particularly valuable against Fusobacteria-related infections.

The availability of recombinant SecF facilitates these research directions by providing access to purified protein for structural, biochemical, and functional studies without the challenges of working directly with the original organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.