Recombinant Sec-independent protein translocase protein TatC (tatC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tatC; Sec-independent protein translocase protein TatC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Azotobacter chroococcum mcd 1
Target Names
tatC
Target Protein Sequence
MTARPDSDQDMPLVAHLTELRSRLLRSVAAVLLIFAALFYFAQDIYALVSAPLRAYLPEG ATMIATGVASPFLAPFKLTLMISLFLAMPVVLHQVWGFIAPGLYQHEKRIAMPLMASSVL LFYAGMAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEVPVATF LLIWVGIVDVASLRNSRPYVIVGCFVVGMVLTPPDVFSQTLLAVPMWLLFEIGVFFGARI RHREEPAASDGPSQP
Uniprot No.

Target Background

Function

TatC is a component of the twin-arginine translocation (Tat) system, responsible for transporting large, folded proteins across membranes. These proteins possess a characteristic twin-arginine motif within their signal peptide. TatC, in conjunction with TatB, forms a receptor that directly interacts with Tat signal peptides.

Protein Families
TatC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Sec-independent protein translocase protein TatC and what is its role in bacterial protein translocation?

TatC is an integral membrane protein that serves as a core component of the twin-arginine translocation (Tat) pathway in bacteria. This pathway is responsible for transporting fully folded proteins across the cytoplasmic membrane. TatC functions within a complex that includes TatA, TatB, and TatE proteins, with TatC playing a crucial role in recognizing the twin-arginine motif in signal peptides of substrate proteins . The Tat pathway is unique compared to the Sec pathway as it can transport proteins that have already folded in the cytoplasm, including those with cofactors, assembled protein complexes, and certain membrane proteins .

What is the relationship between TatC and other components of the Tat machinery?

TatC forms functional complexes with other Tat proteins, particularly TatB. Experimental evidence indicates that TatC is rapidly degraded in the absence of TatB, suggesting that TatB not only interacts with TatC but also stabilizes it . While TatA and TatE appear to be functionally interchangeable (as demonstrated through complementation studies), TatB is functionally distinct and cannot be replaced by these homologs . This functional specialization is further supported by cross-species complementation experiments where Helicobacter pylori tatA could complement an E. coli tatA mutant but not a tatB mutant . These relationships highlight the specialized roles of each component within the translocase complex and how they work together to achieve protein translocation.

What are the recommended approaches for expressing and purifying recombinant TatC for structural studies?

When expressing and purifying recombinant TatC for structural studies, researchers should consider several methodological factors. As an integral membrane protein, TatC presents challenges for traditional expression systems. A recommended approach includes:

  • Expression system selection: E. coli-based expression systems using specialized strains like C41(DE3) or C43(DE3) that are adapted for membrane protein expression.

  • Vector design: Incorporate affinity tags (His6 or Strep-tag II) at either the N or C-terminus, avoiding disruption of transmembrane domains by consulting topology predictions.

  • Induction conditions: Use lower temperatures (16-20°C) and reduced inducer concentrations to promote proper folding and membrane insertion.

  • Detergent selection: Screen multiple detergents for solubilization (common choices include DDM, LMNG, and GDN), as detergent choice significantly impacts protein stability and activity.

  • Purification strategy: Employ a two-step purification combining affinity chromatography followed by size exclusion chromatography to achieve high purity.

These approaches should be optimized according to the specific research questions and downstream applications .

How can researchers effectively design experiments to study TatC interactions with substrate proteins?

Designing experiments to study TatC interactions with substrate proteins requires carefully structured approaches that enable detection of potentially transient interactions. Effective experimental designs include:

  • In vivo crosslinking: Using photo-activatable or chemical crosslinkers to capture interactions in native membrane environments followed by immunoprecipitation and mass spectrometry analysis.

  • Site-specific mutagenesis: Systematic alteration of conserved residues in TatC to identify interaction sites, followed by functional assays to assess impact on substrate binding or translocation.

  • Reconstitution systems: Development of proteoliposomes containing purified TatC components to study interactions in controlled environments with labeled substrate proteins.

  • FRET-based approaches: Utilizing fluorescently tagged TatC and substrate proteins to monitor binding events in real-time.

  • Split-reporter systems: Employing split-GFP or similar approaches where fragments are fused to TatC and potential substrates, allowing visualization of interactions when the protein fragments come together.

For data analysis, researchers should apply statistical methods appropriate for their experimental design, carefully considering issues of multiple testing when screening numerous potential interaction sites .

What are the current methods for analyzing TatC topology and how can contradictory results be resolved?

Analyzing TatC topology requires multiple complementary approaches as single methods often yield incomplete or potentially contradictory results. Current methodological approaches include:

  • Computational predictions: Using algorithms like TMHMM, HMMTOP, and Phobius to predict transmembrane segments based on amino acid sequence.

  • Fusion reporter approaches: Creating fusions with reporters like PhoA (active in periplasm) and GFP (fluorescent in cytoplasm) at various positions to experimentally map topology.

  • Cysteine accessibility methods: Introducing cysteine residues at specific locations and testing their accessibility to membrane-impermeable labeling reagents.

  • Protease protection assays: Using proteases to cleave exposed regions in inside-out or right-side-out membrane vesicles.

  • Cryo-EM or X-ray crystallography: Providing high-resolution structural data when successful.

When contradictory results emerge between different methods, they should be systematically analyzed rather than dismissed. Resolution strategies include:

  • Method-specific artifacts assessment: Evaluate whether fusion proteins might disrupt native folding or if prediction algorithms have known weaknesses for proteins like TatC.

  • Dynamic topology consideration: Investigate whether TatC undergoes conformational changes during the translocation cycle that might explain differing results.

  • Experimental consensus approach: Implement a scoring system that weights results based on multiple independent methods to arrive at the most probable topology model.

  • Focused high-resolution studies: Target contested regions with high-resolution approaches like hydrogen-deuterium exchange mass spectrometry.

This systematic approach helps reconcile discrepancies while building a more accurate model of TatC structure .

How does TatC function differ between Gram-negative and Gram-positive bacteria?

TatC function exhibits both conservation and divergence between Gram-negative and Gram-positive bacteria, reflecting adaptations to their distinct cell envelope structures. Key differences include:

FeatureGram-negative TatCGram-positive TatC
Complex compositionTypically requires TatA, TatB, TatC, and sometimes TatEOften lacks distinct TatB, using a bifunctional TatA
Membrane environmentInner membrane of dual-membrane systemSingle cytoplasmic membrane
Substrate profileDiverse substrates including redox enzymes, membrane proteinsOften more specialized, frequently involved in cell wall biosynthesis
Signal peptide recognitionTypically requires the (S/T)RRXFLK motifSignal peptides often contain additional features beyond the twin-arginine motif
Energy requirementsPrimarily proton motive force dependentSimilar proton motive force dependence

In Gram-negative bacteria like E. coli, TatC functions within a complex containing separate TatA, TatB, and TatC proteins. In contrast, many Gram-positive organisms like Bacillus subtilis possess multiple minimal Tat systems consisting of TatA and TatC only, with TatA functioning in roles performed by both TatA and TatB in Gram-negative systems .

These differences highlight evolutionary adaptations to different cellular architectures while maintaining the core function of translocating folded proteins across membranes.

What experimental approaches can be used to study the evolution of TatC across different bacterial species?

Studying TatC evolution across bacterial species requires methodologies that integrate phylogenetic, structural, and functional analyses. Effective experimental approaches include:

  • Comparative genomics: Analyze TatC sequences across diverse bacterial phyla to identify conserved domains, signature motifs, and lineage-specific adaptations. Mapping conservation patterns onto structural models can reveal functionally critical regions.

  • Horizontal gene transfer analysis: Employ phylogenetic incongruence methods to detect instances of horizontal gene transfer of tat genes, which may indicate adaptive acquisition of protein export capabilities.

  • Cross-species complementation experiments: Express TatC from diverse species in model organism tat mutants (e.g., E. coli ΔtatC) to assess functional conservation and specialization. This approach has revealed, for example, that H. pylori TatA can complement E. coli TatA but not TatB function .

  • Ancestral sequence reconstruction: Computationally infer ancestral TatC sequences and express these reconstructed proteins to test hypotheses about functional evolution.

  • Co-evolution analysis: Identify co-evolving residues between TatC and other Tat components or between TatC and substrate signal peptides to map evolutionary constraints.

  • Directed evolution experiments: Subject TatC to laboratory evolution under defined selective pressures to observe adaptation pathways and compare to natural evolutionary trajectories.

These approaches, when integrated, provide insights into how TatC has diversified while maintaining its core function across bacterial lineages.

What evidence supports the model that TatC forms a complex with TatB?

Multiple lines of experimental evidence support the model that TatC forms a complex with TatB:

  • Protein stability studies: Research has demonstrated that TatC is rapidly degraded in the absence of TatB, strongly suggesting that TatB stabilizes TatC through direct interaction .

  • Co-purification experiments: TatB consistently co-purifies with affinity-tagged TatC during isolation procedures, indicating a stable association between these proteins.

  • Cross-linking studies: Chemical cross-linking experiments have captured direct contacts between TatB and TatC residues, mapping specific interaction interfaces.

  • Genetic studies: Deletion of the tatB gene alone is sufficient to block the export of seven endogenous Tat substrates in E. coli, including hydrogenase-2, indicating its essential role in the functional complex .

  • Complementation analysis: While TatA and TatE appear functionally interchangeable, TatB is functionally distinct and cannot be complemented by these homologues, suggesting a specialized role in complex with TatC .

  • Structural studies: Electron microscopy of purified TatBC complexes reveals defined structures with specific stoichiometry, supporting their association as a functional unit.

This evidence collectively establishes that TatB and TatC form a functional complex essential for Tat-dependent protein transport.

How can researchers investigate the dynamic assembly of the TatABC complex during protein translocation?

Investigating the dynamic assembly of the TatABC complex during protein translocation requires techniques that can capture transient states and conformational changes. Researchers should consider these methodological approaches:

  • Time-resolved crosslinking: Apply rapid crosslinking at defined time points after initiating translocation to capture intermediate assembly states.

  • Single-molecule FRET: Label different Tat components with FRET pairs to monitor distance changes and component recruitment during translocation events in real-time.

  • Cryo-electron microscopy: Use time-resolved cryo-EM sample preparation to visualize different assembly states captured at various stages of translocation.

  • Hydrogen-deuterium exchange mass spectrometry: Monitor the accessibility of different protein regions during translocation to track conformational changes.

  • Electrophysiology: Reconstitute Tat components in planar lipid bilayers and measure conductance changes during substrate interaction and translocation.

  • Super-resolution microscopy: Track fluorescently labeled Tat components in live cells to monitor dynamic clustering during active translocation.

  • Molecular dynamics simulations: Complement experimental data with simulations that can provide atomic-level insights into complex assembly mechanisms.

For data analysis, researchers should employ statistical methods appropriate for time-series data, potentially including hidden Markov models to identify discrete states in the assembly pathway .

What are common pitfalls in experimental design when studying TatC function, and how can they be avoided?

When designing experiments to study TatC function, researchers commonly encounter several methodological challenges that can compromise data quality and interpretation. These pitfalls and their solutions include:

  • Signal peptide specificity misinterpretation

    • Pitfall: Assuming that the twin-arginine motif alone determines Tat pathway specificity.

    • Solution: Consider the c-region charge and N-terminal mature protein charges together, as a net charge of +2 or higher results in Tat specificity while -1 or lower can lead to promiscuity between pathways .

  • Membrane protein purification artifacts

    • Pitfall: Detergent selection affecting TatC stability and interactions.

    • Solution: Screen multiple detergents systematically; consider nanodisc or styrene-maleic acid lipid particle (SMALP) approaches that better preserve the native lipid environment.

  • In vitro transport assay limitations

    • Pitfall: Failure to establish proper membrane potential in reconstituted systems.

    • Solution: Carefully monitor and confirm the presence of proton motive force; include appropriate controls with protonophores to demonstrate energy dependence.

  • Incomplete complex formation

    • Pitfall: Studying TatC in isolation despite evidence that it forms functional complexes with TatB and is unstable without it .

    • Solution: Co-express and co-purify TatB with TatC to maintain physiologically relevant complexes.

  • Mutation effect misinterpretation

    • Pitfall: Attributing phenotypes of point mutations directly to interaction disruption rather than protein stability issues.

    • Solution: Perform careful controls for expression, stability, and membrane insertion of mutant proteins before interpreting functional defects.

Addressing these challenges systematically improves experimental rigor and data interpretation in TatC research.

How can researchers resolve contradictory data about TatC topology or function from different experimental approaches?

When faced with contradictory data about TatC topology or function from different experimental approaches, researchers should implement a systematic resolution framework:

  • Methodological limitations assessment:

    • Evaluate each method's known biases and limitations (e.g., fusion tags may disrupt native folding, crosslinking can capture non-physiological interactions)

    • Document experimental conditions that might introduce artifacts (detergent effects, non-native expression levels)

  • Weighted evidence approach:

    • Assign confidence scores to data based on methodology robustness

    • Give higher weight to methods that preserve native membrane environment

    • Consider methods that directly probe function over purely structural approaches

  • Reconciliation through comprehensive modeling:

    • Develop multiple working models that could explain seemingly contradictory results

    • Test predictions unique to each model with orthogonal methods

    • Consider dynamic models where TatC might adopt different conformations during translocation cycle

  • Statistical analysis of experimental variability:

    • Apply appropriate statistical tests to determine if contradictory results are statistically significant

    • Consider Bayesian approaches that can incorporate prior knowledge

    • Use power analysis to ensure adequate sampling

  • Direct comparison experiments:

    • Design experiments that directly compare methods under identical conditions

    • Standardize protocols and reagents across research groups

    • Implement blind analysis procedures to minimize bias

How can the Tat pathway and TatC be engineered for biotechnology applications?

The unique ability of the Tat pathway to transport folded proteins makes it particularly valuable for biotechnology applications. Advanced engineering approaches include:

  • Recombinant protein secretion optimization:

    • Engineer signal peptides with optimized twin-arginine motifs and c-region charges for increased export efficiency

    • Develop tunable TatC variants that allow controlled export rates for proteins that are toxic at high concentrations

    • Co-express TatB and TatC at defined ratios to maximize complex formation and stability

  • Membrane protein production:

    • Exploit the Tat pathway's ability to insert certain membrane proteins laterally, independent of YidC

    • Design chimeric constructs that leverage the C-tail membrane anchoring mechanism observed with hydrogenases

  • Biotechnology applications for difficult-to-express proteins:

    • Utilize the Tat pathway for proteins requiring cytoplasmic folding or cofactor insertion prior to export

    • Develop systems for proteins that cannot fold properly in the periplasm, similar to GFP which is only fluorescent when exported via Tat

  • Vaccine development platforms:

    • Design fusion constructs where antigens are exported in their folded, immunogenic conformation

    • Develop bacterial strains with enhanced Tat capacity for increased antigen display

  • Biosensor development:

    • Create split reporter systems where TatC-dependent translocation triggers sensor activation

    • Design feedback-regulated export systems for continuous environmental monitoring

These applications build on fundamental knowledge of TatC function while expanding the biotechnological toolkit for difficult-to-express proteins.

What are the current hypotheses about how TatC recognizes properly folded versus misfolded substrate proteins?

The Tat pathway's ability to selectively transport properly folded proteins is one of its most remarkable features. Current hypotheses about the quality control mechanisms include:

  • Conformational proofreading model:

    • TatC may directly recognize exposed hydrophobic patches characteristic of misfolded proteins

    • Binding of the signal peptide may trigger a conformational change in TatC that enables assessment of substrate folding state

    • Properly folded proteins may present specific surface features that facilitate productive interactions with the translocase

  • Energy-dependent rejection model:

    • Initial binding may occur regardless of folding state

    • Subsequent steps requiring proton motive force may actively reject misfolded proteins

    • This model suggests energy is required not just for translocation but also for quality control

  • Partner protein quality control:

    • Cytoplasmic chaperones may act as gatekeepers, only delivering properly folded substrates to the Tat machinery

    • This hypothesis is supported by observations of chaperone interactions with Tat substrates prior to transport

  • Size-restriction hypothesis:

    • The Tat translocon may have physical constraints that prevent passage of misfolded proteins that exceed certain dimensions

    • Compactly folded native proteins may fit through size-restricted pores or channels

  • Charge-based quality control:

    • Misfolded proteins may expose charged residues normally buried in the hydrophobic core

    • TatC might recognize these aberrant charge distributions as signals to abort translocation

These hypotheses are not mutually exclusive, and the actual mechanism may involve multiple quality control checkpoints. Current research is focused on developing experimental approaches to test these models, potentially revealing principles that could be applied to engineered quality control systems.

What computational approaches can predict novel TatC substrates and their transport efficiency?

Advanced computational approaches for predicting novel TatC substrates and their transport efficiency integrate multiple data types and algorithmic strategies:

  • Machine learning models for signal peptide recognition:

    • Deep learning algorithms trained on known Tat substrates can identify subtle patterns beyond the twin-arginine motif

    • Feature extraction methods that incorporate the c-region charge distribution and N-terminal mature protein charges

    • Models that consider secondary structure propensity around the signal peptide cleavage site

  • Folding state prediction integration:

    • Algorithms that predict protein folding stability and cofactor binding requirements

    • Models that estimate the likelihood of successful cytoplasmic folding

    • Integration of disorder prediction to identify regions that might interfere with Tat transport

  • Molecular dynamics simulations:

    • Simulations of signal peptide interaction with the TatBC complex

    • Modeling of substrate passage through the translocation channel

    • Energetic calculations of transport feasibility based on substrate properties

  • Transport efficiency prediction metrics:

    • Scoring systems based on signal peptide optimization (consensus twin-arginine motif adherence)

    • Estimates based on protein size and folding compactness

    • Predictions accounting for known rate-limiting steps in Tat transport

  • Genomic context analysis:

    • Identification of genes co-regulated with known Tat substrates

    • Operon structure analysis to find proteins functionally linked to Tat-dependent processes

    • Evolutionary co-occurrence patterns of TatC and potential substrates

These computational approaches can be validated through experimental testing of predicted novel substrates, creating an iterative improvement cycle that enhances prediction accuracy while expanding our understanding of Tat pathway specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.