Recombinant Secale cereale Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

CP47 (psbB) acts as a core antenna component, transferring excitation energy to the PSII reaction center (D1/D2 heterodimer). Key functions include:

  • Chlorophyll Organization: Stabilizes 16 chlorophyll a and β-carotene molecules, facilitating light absorption .

  • Structural Anchoring: Interacts with CP43, PsbH, and PsbL to maintain PSII core integrity .

  • Electron Transfer: Facilitates energy transfer to the reaction center via proximity to the D2 subunit .

Production and Purification

Recombinant psbB is produced in E. coli and purified via affinity chromatography. Critical parameters include:

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
Storage BufferTris-based buffer with 50% glycerol, pH 8.0
Purity>90% (SDS-PAGE confirmed)
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Assembly and Maturation

  • Auxiliary Proteins: FPB1 and PAM68 coordinate with Alb3 to integrate CP47 into PSII .

  • Genetic Context: The psbB gene resides in the large single-copy (LSC) region of S. cereale’s chloroplast genome .

Biotechnological Relevance

  • ELISA Kits: Used to detect psbB in plant tissues or recombinant preparations .

  • Stress Response: Pb exposure alters chlorophyll-protein complex organization in S. cereale, impacting PSII efficiency .

Key Research Findings

Study FocusKey FindingsReferences
Structural ModelingSix TMDs with 5 His residues directly ligating chlorophyll
Assembly FactorsFPB1 and PAM68 assist CP47 integration into PSII
Genetic AnalysispsbB located in LSC region of S. cereale chloroplast genome
Post-TranslationalLipid modifications in Psb27 influence PSII maturation (indirect relevance)

Challenges and Future Directions

  • Genetic Recalcitrance: S. cereale’s low tissue culture response limits biotechnological applications .

  • Stress Tolerance: Pb-induced structural changes in PSII warrant further study for crop resilience .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributor.
Important: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is decided during the production process. If you have a preferred tag type, please inform us, and we will prioritize its implementation if possible.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Secale cereale (Rye)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGTHIVFSGLCFLAAIWHWVYWDL EIFSDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV
Uniprot No.

Target Background

Function
As a key component of the photosystem II (PSII) core complex, CP47 (chlorophyll apoprotein, encoded by the psbB gene) plays a crucial role in the light-driven photochemical reactions of PSII. It binds chlorophyll and participates in catalyzing the primary light-induced events within PSII. PSII, acting as a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from water, generating oxygen (O2) and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem II CP47 chlorophyll apoprotein (psbB) and what is its role in Secale cereale?

Photosystem II CP47 chlorophyll apoprotein, encoded by the psbB gene, is a critical component of the photosynthetic machinery in Secale cereale (rye). This 47 kDa protein serves as an internal antenna complex, coordinating chlorophyll molecules that harvest light energy and transfer it to the photosystem II reaction center. The protein contains multiple membrane-spanning domains and is characterized by its distinctive amino acid sequence starting with MGLPWYRVHT and extending to 508 amino acids in length . Within the thylakoid membrane, CP47 functions to expand the light-harvesting capacity of photosystem II while also maintaining structural stability of the protein complex. The recombinant form preserves the functional domains of the native protein while allowing for controlled expression and purification for research applications.

What expression systems are typically used for recombinant psbB production?

Escherichia coli is the most commonly employed expression system for recombinant psbB production due to its rapid growth rate, high cell density capacity, relatively inexpensive substrate requirements, and well-established genetic manipulation techniques . The selection of an appropriate expression system depends on several factors including desired protein yield, post-translational modifications, and downstream applications. While E. coli remains the workhorse for basic research applications, alternative systems such as yeast, insect cells, or plant-based expression systems may be considered when specific structural features or post-translational modifications are required. The optimization of expression conditions is typically conducted through factorial design experiments that systematically evaluate multiple variables simultaneously to determine optimal conditions for soluble protein production .

How should recombinant Secale cereale psbB protein be stored to maintain activity?

Proper storage of recombinant Secale cereale psbB protein is crucial for maintaining structural integrity and functional activity. The recommended storage conditions include:

  • Short-term storage (≤1 week): 4°C in Tris-based buffer with 50% glycerol

  • Medium-term storage: -20°C in aliquots to minimize freeze-thaw cycles

  • Long-term storage: -80°C in Tris-based buffer with 50% glycerol

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. Working aliquots should be prepared during initial processing to minimize the need for multiple freeze-thaw events. The inclusion of glycerol (typically at 50%) in the storage buffer serves as a cryoprotectant, preventing ice crystal formation that can disrupt protein structure. Additionally, the use of protease inhibitors in storage buffers may be beneficial for maintaining protein integrity over extended periods.

What experimental design approaches optimize soluble expression of recombinant psbB protein?

Optimization of soluble recombinant psbB expression requires a systematic evaluation of multiple variables through statistical experimental design methodologies. Unlike traditional univariate approaches where each variable is tested independently, multivariate factorial designs allow researchers to assess variable interactions while minimizing experimental runs .

A 2^8-4 fractional factorial design can effectively evaluate eight variables at two levels each through just 16 experimental conditions. Critical variables to consider include:

  • Induction temperature (typically 25°C vs. 37°C)

  • Inducer concentration (e.g., 0.1 mM vs. 1.0 mM IPTG)

  • Induction time (typically 4-6 hours)

  • Cell density at induction (e.g., OD600 of 0.6 vs. 1.0)

  • Media composition (e.g., varying concentrations of yeast extract, tryptone)

  • Glucose concentration

  • Expression vector design

  • Host strain selection

Based on experimental design studies of similar recombinant proteins, optimal conditions often include induction at moderate cell density (OD600 of 0.8), lower temperatures (25°C), reduced inducer concentration (0.1 mM IPTG), and expression duration of approximately 4 hours in media containing 5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, and 1 g/L glucose . These conditions can significantly increase the yield of soluble protein (potentially up to 250 mg/L) while reducing the formation of inclusion bodies.

How can researchers evaluate the functional activity of recombinant psbB protein?

Functional evaluation of recombinant psbB protein can be conducted through multiple complementary approaches:

  • Spectroscopic Analysis: Absorption and fluorescence spectroscopy can assess chlorophyll binding capacity and energy transfer efficiency. Characteristic absorption peaks at 436 nm and 672 nm indicate proper protein folding and chlorophyll coordination.

  • Reconstitution Assays: In vitro reconstitution with purified chlorophyll molecules followed by measurement of energy transfer efficiency can verify functional activity.

  • Thermal Stability Assessment: Differential scanning calorimetry (DSC) or thermal shift assays can evaluate protein stability and proper folding.

  • Binding Partner Interaction Studies: Pull-down assays or surface plasmon resonance (SPR) can confirm interactions with other photosystem II components.

  • Structural Integrity Verification: Circular dichroism (CD) spectroscopy can verify secondary structure composition consistent with properly folded protein.

The selection of appropriate functional assays depends on research objectives and available equipment. Researchers should consider establishing a reference standard of native protein activity when possible to enable comparative analysis.

What strategies can overcome inclusion body formation when expressing recombinant psbB?

Inclusion body formation represents a significant challenge in recombinant membrane protein expression. Several strategies can mitigate this issue:

  • Temperature Modulation: Reducing expression temperature to 15-25°C slows protein synthesis, allowing more time for proper folding .

  • Co-expression with Chaperones: Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance proper folding.

  • Fusion Tags: Solubility-enhancing fusion partners (MBP, SUMO, TrxA) can significantly improve soluble expression.

  • Media Optimization: Enriched media formulations with osmolytes or specific amino acid supplements can improve protein folding.

  • Induction Strategy Modification: Employing auto-induction media or reduced inducer concentrations with extended expression times can enhance soluble yields.

  • Host Strain Selection: Specialized E. coli strains (e.g., C41(DE3), C43(DE3), Origami) designed for membrane protein expression can reduce inclusion body formation.

Implementation of a factorial design approach allows systematic evaluation of these strategies in combination, as variable interactions often prove critical in optimizing soluble expression .

What purification methodology is most effective for recombinant psbB protein?

Purification of recombinant psbB protein requires a multi-step approach that preserves protein structure and function. The following methodology represents a strategic workflow:

Purification StepMethodBuffer ConditionsExpected Outcome
Cell LysisSonication or French Press50 mM Tris-HCl (pH 8.0), 150 mM NaCl, 10% glycerol, protease inhibitorsComplete cell disruption with preserved protein structure
ClarificationCentrifugation (20,000 × g, 30 min)Same as lysis bufferRemoval of cell debris
Affinity ChromatographyImmobilized metal affinity chromatography (IMAC)Binding: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole
Elution: 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 250 mM imidazole
Capture of His-tagged protein with ~75% purity
Ion Exchange ChromatographyAnion exchange (Q Sepharose)Binding: 20 mM Tris-HCl (pH 8.0), 50 mM NaCl
Elution: 20 mM Tris-HCl (pH 8.0), 50-500 mM NaCl gradient
Removal of contaminants based on charge differences
Size Exclusion ChromatographySuperdex 20020 mM Tris-HCl (pH 8.0), 150 mM NaCl, 5% glycerolFinal polishing step to achieve >95% purity

Throughout the purification process, protein stability should be monitored using activity assays and structural analysis techniques. The inclusion of stabilizing agents (glycerol, specific detergents) in purification buffers can significantly enhance protein stability and recovery. Final purified protein should be assessed for purity by SDS-PAGE and verified for identity using Western blotting or mass spectrometry.

How can researchers design quantitative assays to measure psbB expression levels?

Quantitative assessment of psbB expression requires reliable assays that can accurately measure protein concentration and activity. Recommended methodological approaches include:

  • qRT-PCR for Transcript Analysis:

    • Design gene-specific primers targeting unique regions of the psbB gene

    • Normalize expression against stable reference genes (e.g., actin, GAPDH)

    • Calculate relative expression using the 2^-ΔΔCt method

  • ELISA-Based Protein Quantification:

    • Develop sandwich ELISA using anti-psbB antibodies

    • Generate standard curve using purified recombinant protein

    • Validate assay for specificity, sensitivity, and reproducibility

  • Western Blot Quantification:

    • Use purified recombinant psbB as standard

    • Employ fluorescent secondary antibodies for linear dynamic range

    • Analyze band intensity using appropriate software (ImageJ, etc.)

  • Spectroscopic Activity Assays:

    • Measure chlorophyll binding through absorbance spectroscopy

    • Quantify energy transfer efficiency through fluorescence assays

    • Correlate activity measurements with protein concentration

Each quantification method should be validated using appropriate controls and statistical analysis to ensure reliability and reproducibility. Method selection should align with research objectives and available resources.

What statistical approaches are recommended for optimizing experimental design in psbB expression studies?

Statistical design of experiments (DoE) represents a powerful approach for optimizing recombinant psbB expression. The following methodological framework is recommended:

  • Screening Design: Implement fractional factorial designs (e.g., 2^8-4) to identify significant variables among multiple factors with minimal experimental runs .

  • Response Surface Methodology (RSM): Once significant factors are identified, employ central composite design (CCD) or Box-Behnken design to model the response surface and identify optimal conditions.

  • Statistical Analysis Framework:

    • ANOVA to determine statistical significance of each factor

    • Multiple regression analysis to generate predictive models

    • Pareto charts to visualize relative importance of factors and interactions

    • Contour plots to identify optimal operating regions

  • Validation Strategy:

    • Confirm predicted optimal conditions through triplicate experiments

    • Calculate confidence intervals for predicted responses

    • Implement process control monitoring to ensure reproducibility

This statistical approach significantly reduces experimental burden while providing robust optimization. Software packages such as Design-Expert, JMP, or R with appropriate packages can facilitate design generation and analysis. The use of DoE methodology can reduce the development time for expression protocols by up to 75% compared to univariate approaches while identifying important interaction effects that might otherwise be missed .

How can recombinant psbB be used to study photosystem assembly mechanisms?

Recombinant psbB protein serves as a valuable tool for investigating photosystem II assembly mechanisms through several methodological approaches:

  • In vitro Reconstitution Studies: Purified recombinant psbB can be combined with other photosystem components under controlled conditions to study assembly kinetics and intermediate complex formation. This approach allows researchers to identify critical interaction interfaces and assembly checkpoints.

  • Mutagenesis Analysis: Site-directed mutagenesis of recombinant psbB enables systematic evaluation of amino acid residues critical for protein-protein interactions, chlorophyll binding, and complex stability. Mutation of specific residues in the amino acid sequence (such as those in transmembrane regions or chlorophyll-binding sites) can provide insights into structure-function relationships.

  • Interaction Mapping: Pull-down assays, surface plasmon resonance, or hydrogen-deuterium exchange mass spectrometry using recombinant psbB can map interaction networks within the photosystem complex, revealing assembly pathways and regulatory mechanisms.

  • Complementation Studies: Recombinant psbB can be used in complementation experiments with psbB-deficient mutants to verify functionality and assess the impact of specific mutations on photosystem assembly in vivo.

These approaches collectively provide a comprehensive understanding of how CP47 integrates into the photosystem II complex and contributes to photosynthetic function.

What comparative approaches can evaluate structural differences between native and recombinant psbB protein?

Structural comparison between native and recombinant psbB protein requires multiple complementary techniques:

What emerging technologies are advancing recombinant psbB research?

Recent technological advances are transforming recombinant psbB research in several key areas:

  • Cell-Free Protein Synthesis Systems: These systems bypass cellular constraints, allowing direct synthesis of difficult membrane proteins like psbB in the presence of lipids or detergents, potentially improving folding and functionality.

  • Cryo-Electron Microscopy: Advances in cryo-EM now enable high-resolution structural analysis of membrane protein complexes containing psbB without crystallization, revealing dynamic assemblies.

  • Nanodiscs and Styrene-Maleic Acid Lipid Particles (SMALPs): These technologies provide native-like membrane environments for recombinant psbB, improving stability and functional analysis.

  • Computational Protein Design: Machine learning approaches are enhancing the prediction of stabilizing mutations and optimal expression conditions for recombinant psbB.

  • High-Throughput Microfluidic Platforms: These systems enable rapid screening of expression conditions with minimal sample requirements, accelerating optimization.

These emerging technologies collectively enhance our ability to study the structure, function, and assembly of photosystem II components, providing deeper insights into photosynthetic mechanisms.

What are the current challenges and future perspectives in recombinant psbB research?

Despite significant advances, several challenges remain in recombinant psbB research:

  • Membrane Protein Solubility: The hydrophobic nature of psbB continues to challenge expression systems, requiring innovative approaches to maintain proper folding and solubility.

  • Functional Reconstitution: Complete functional reconstitution of psbB within photosystem II complexes remains technically challenging, limiting certain functional studies.

  • Post-translational Modifications: Bacterial expression systems lack the machinery for plant-specific post-translational modifications, potentially affecting protein function.

  • Structural Dynamics: Current methodologies provide limited insights into the dynamic structural changes of psbB during photosynthetic function.

Future research directions should focus on:

  • Development of improved expression systems specifically designed for membrane proteins

  • Advanced biophysical techniques to study dynamic structural changes during photosystem assembly

  • Integration of computational approaches with experimental validation to predict optimal expression conditions

  • Application of synthetic biology principles to engineer enhanced photosynthetic complexes

Progress in these areas will significantly advance our understanding of photosystem II function and potentially contribute to improved photosynthetic efficiency in agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.