The D2 protein (encoded by the psbD gene) is a transmembrane component of PSII. It partners with the D1 protein to form the reaction center heterodimer, which binds redox-active cofactors essential for electron transport . Key features include:
Expression System: Most commonly produced in E. coli with N-terminal His tags for purification .
Sequence: Full-length (residues 1–353) with the amino acid sequence:
MTIALGRIPKEENDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY...GNAL .
Yield: ≥90% purity via SDS-PAGE, with lyophilized or liquid formulations .
Electron Transport: The D2 protein binds plastoquinone (Q<sub>A</sub>), enabling electron transfer to Q<sub>B</sub> . Mutations in psbD disrupt PSII assembly and quinone binding .
In Vitro Reconstitution: Truncated D2 polypeptides (e.g., 30 kDa, 25 kDa) generated via internal translation initiation retain partial function in quinone binding .
Assembly Intermediates: Psb28 binding induces conformational changes in PSII, altering the Q<sub>B</sub> pocket and replacing bicarbonate with glutamate at the non-heme iron site .
Limitations: In vascular plants, psbD transcript abundance—not translation efficiency—determines D2 synthesis rates .
Stability Issues: Repeated freeze-thaw cycles degrade the protein; aliquoting in glycerol-containing buffers is recommended .
Functional Aggregates: Homomeric aggregates (e.g., 46 kDa) observed during in vitro translation complicate activity assays .
Biotechnological Potential: Engineered psbD variants could enhance PSII efficiency in synthetic photosynthesis systems .