Recombinant Secale cereale Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

The D2 protein (encoded by the psbD gene) is a transmembrane component of PSII. It partners with the D1 protein to form the reaction center heterodimer, which binds redox-active cofactors essential for electron transport . Key features include:

PropertyDetails
Gene NamepsbD (chloroplast-encoded)
Protein Length353 amino acids (full-length)
Molecular FunctionBinds plastoquinone (Q<sub>A</sub>), stabilizes PSII structure
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with glycerol

Expression and Purification

  • Expression System: Most commonly produced in E. coli with N-terminal His tags for purification .

  • Sequence: Full-length (residues 1–353) with the amino acid sequence:
    MTIALGRIPKEENDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY...GNAL .

  • Yield: ≥90% purity via SDS-PAGE, with lyophilized or liquid formulations .

Functional Studies

  • Electron Transport: The D2 protein binds plastoquinone (Q<sub>A</sub>), enabling electron transfer to Q<sub>B</sub> . Mutations in psbD disrupt PSII assembly and quinone binding .

  • In Vitro Reconstitution: Truncated D2 polypeptides (e.g., 30 kDa, 25 kDa) generated via internal translation initiation retain partial function in quinone binding .

Biogenesis Insights

  • Assembly Intermediates: Psb28 binding induces conformational changes in PSII, altering the Q<sub>B</sub> pocket and replacing bicarbonate with glutamate at the non-heme iron site .

  • Limitations: In vascular plants, psbD transcript abundance—not translation efficiency—determines D2 synthesis rates .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; aliquoting in glycerol-containing buffers is recommended .

  • Functional Aggregates: Homomeric aggregates (e.g., 46 kDa) observed during in vitro translation complicate activity assays .

  • Biotechnological Potential: Engineered psbD variants could enhance PSII efficiency in synthetic photosynthesis systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Secale cereale (Rye)
Target Names
psbD
Target Protein Sequence
MTIALGRIPKEENDLFDTMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FALIGFMLRQFELARSVQLRPYNAISFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient, which is subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is crucial for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.