Recombinant Secale cereale Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Production

Gene and Protein Details

  • Gene Name: psbA (encodes Photosystem II D1 protein) .

  • UniProt ID: P10510 .

  • Expression System: Produced in Escherichia coli with an N-terminal His tag for purification .

  • Amino Acid Sequence: Comprises residues 2–344 of the mature protein, preserving its native structural and functional domains .

Role in Photosystem II

The Q(B) protein forms the PSII reaction center heterodimer with D2 (PsbD), hosting redox-active cofactors :

  • Plastoquinone Binding: Coordinates QA (single-electron acceptor) and QB (double-electron acceptor). QA is tightly bound, while QB is exchangeable post-reduction .

  • Electron Transport: Facilitates electron transfer from pheophytin to plastoquinone, critical for plastoquinol (PQH2) formation .

Interaction Dynamics with Plastoquinones

Comparative analysis of plastoquinone (PQ) binding niches reveals distinct interaction profiles :

FactorQA Binding NicheQB Binding NicheQC Binding Niche
Protein Matrix Contribution100%82%56%
PQ Head Contribution38%44.9%8.8%
PQ Tail Contribution62%56.1%91.2%

QB’s binding is stabilized by hydrogen bonds with D1-Ser264 and D1-His215, while its phytyl tail interacts with hydrophobic residues in the exchange channel .

Functional Impairments

  • Y112L Mutation: Substituting tyrosine with leucine at position 112 disrupts charge recombination (QB⁻/S₂,₃ states), shifting thermoluminescence emission maxima from 35–40°C to 20°C . This alters donor-side activity and accelerates photoinhibition .

  • Pb²⁺ Stress: Exposure to 5 mM Pb(NO₃)₂ reduces chlorophyll a and b content by 30–40%, diminishing light absorption by antenna complexes and PSII fluorescence yield .

Recombinant Expression Challenges

  • High-level expression in chloroplasts (e.g., 30–40% total soluble protein) correlates with reduced Rubisco subunit synthesis, necessitating nitrogen supplementation to mitigate metabolic strain .

Applications and Experimental Use

  • Protein-Protein Interaction Studies: Utilized in cross-linking assays to map PSII subunit interfaces (e.g., PsbP-PsbE interactions) .

  • Photosynthetic Dysfunction Models: Serves as a tool to study abiotic stress responses (e.g., heavy metal toxicity) and herbicide resistance mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Secale cereale (Rye)
Target Names
psbA
Target Protein Sequence
TAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient used for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein in Secale cereale?

Photosystem Q(B) protein in Secale cereale (rye) is a critical component of the photosynthetic apparatus located in the thylakoid membranes of chloroplasts. This protein, also known as the D1 protein (encoded by the psbA gene), functions as an electron acceptor within Photosystem II (PSII), playing an essential role in the light-dependent reactions of photosynthesis. The protein contains binding sites for quinone molecules, specifically plastoquinone B (QB), which accepts electrons during the photosynthetic electron transport chain. In Secale cereale, this protein is part of the chloroplast genome and has been studied for its role in photosynthetic efficiency and stress responses. The protein's function is highly conserved across plant species, though some structural variations may exist between different organisms like Secale cereale and other photosynthetic organisms .

What expression systems are commonly used for recombinant Photosystem Q(B) protein production?

Escherichia coli is the most commonly utilized expression system for the production of recombinant Photosystem Q(B) protein from Secale cereale. The bacterial expression system offers several advantages for protein production, including rapid growth rates, high protein yields, and relatively low production costs. For optimal expression, the gene encoding the Photosystem Q(B) protein is typically cloned into an expression vector containing a strong promoter and often includes an affinity tag (such as a His-tag) to facilitate purification. The protein is typically expressed with an N-terminal His-tag, which allows for efficient purification using nickel affinity chromatography. Following expression in E. coli, the recombinant protein is typically purified under native or denaturing conditions depending on the specific experimental requirements and the intended application of the protein .

What is the amino acid sequence and structure of Secale cereale Photosystem Q(B) protein?

The Photosystem Q(B) protein from Secale cereale, also known as D1 protein and encoded by the psbA gene, consists of approximately 344 amino acids. While the exact sequence for Secale cereale's protein wasn't provided in the search results, related photosystem proteins typically contain multiple transmembrane alpha-helical domains that anchor the protein within the thylakoid membrane. The protein contains binding sites for cofactors including chlorophyll molecules, pheophytin, and the quinone electron acceptors QA and QB.

The general structure of D1 protein includes:

  • N-terminal region exposed to the stromal side

  • Five transmembrane alpha-helical domains

  • Intermembrane loops connecting the transmembrane segments

  • C-terminal region also exposed to the stromal side

The protein forms an integral part of the reaction center of Photosystem II, working in conjunction with the D2 protein to bind the electron transport cofactors necessary for photosynthetic activity. The amino acid sequence is highly conserved across plant species, reflecting its critical role in photosynthesis .

How should recombinant Photosystem Q(B) protein be stored and handled?

For optimal stability and activity, recombinant Photosystem Q(B) protein from Secale cereale should be stored according to the following guidelines:

  • Long-term storage: Store lyophilized protein at -20°C to -80°C.

  • Working solutions: Reconstitute in appropriate buffer (typically Tris/PBS-based buffer, pH 8.0) with 6% trehalose for stability.

  • Concentration: Reconstitute to a final concentration of 0.1-1.0 mg/mL.

  • Aliquoting: Divide into small working aliquots to avoid repeated freeze-thaw cycles.

  • Cryoprotectant: Add glycerol to a final concentration of 50% for freeze-thaw protection.

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week.

The protein should be handled with care to avoid denaturation. Prior to opening, centrifuge the vial briefly to bring contents to the bottom. Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity. When reconstituting lyophilized protein, allow the solution to sit for a few minutes at room temperature with gentle agitation before use. The addition of protease inhibitors may be beneficial when working with the protein for extended periods .

How does lead ion (Pb2+) stress affect Photosystem Q(B) protein function in Secale cereale?

Lead ion stress significantly impacts the structure and function of photosynthetic complexes in Secale cereale, including the Photosystem Q(B) protein. Research has demonstrated that exposure to Pb(NO₃)₂ at concentrations of 2 mM and 5 mM induces several measurable changes in photosystem functionality:

These changes collectively indicate that Pb²⁺ stress disrupts the normal electron transfer processes in which the Photosystem Q(B) protein is involved, potentially by altering protein conformation or by interfering with cofactor binding .

What methods are recommended for analyzing the structure-function relationship of recombinant Photosystem Q(B) protein?

Several complementary analytical approaches are recommended for comprehensive structure-function analysis of recombinant Photosystem Q(B) protein from Secale cereale:

  • Spectroscopic Analysis:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure elements

    • Fluorescence spectroscopy to assess chlorophyll-protein interactions and conformational changes

    • Absorption spectroscopy to examine pigment binding and protein-cofactor interactions

  • Functional Assays:

    • Oxygen evolution measurements to assess electron transport activity

    • Chlorophyll fluorescence induction to evaluate photochemical (qp) and non-photochemical (qn) quenching parameters

    • Electron transport rate measurements using artificial electron acceptors

  • Structural Analysis:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

    • Non-denaturing electrophoresis to analyze oligomeric states and protein-protein interactions

    • Mass spectrometry for protein identification and post-translational modifications analysis

  • Molecular Dynamics:

    • In silico modeling and simulation to predict protein-ligand interactions

    • Site-directed mutagenesis to identify critical amino acid residues for function

    • Hydrogen/deuterium exchange mass spectrometry to probe protein dynamics

For comprehensive structure-function analysis, researchers should combine biophysical methods with biochemical approaches to correlate structural features with functional properties under various experimental conditions .

How does the genetic sequence of the psbA gene in Secale cereale compare to other crops?

The psbA gene, which encodes the Photosystem Q(B) protein (D1 protein) in Secale cereale, shows high sequence conservation when compared to other crop species, particularly within the Poaceae family. Analysis of the chloroplast genome reveals several key characteristics:

  • Sequence conservation: The psbA gene in Secale cereale shows high sequence identity (>95%) with other cereal crops such as wheat (Triticum aestivum), barley (Hordeum vulgare), and maize (Zea mays), reflecting the functional importance of this gene in photosynthesis.

  • Genomic location: In Secale cereale, the psbA gene is located in the large single copy (LSC) region of the chloroplast genome, which spans approximately 81,060 bp in total length.

  • Gene structure: The psbA gene in Secale cereale lacks introns, a feature conserved across most plant species, facilitating efficient gene expression in the chloroplast.

  • Conserved regions: The highest sequence conservation occurs in regions encoding functional domains involved in cofactor binding and electron transport.

  • Regulatory elements: The promoter regions of the psbA gene show more variation between species compared to the coding regions, potentially reflecting adaptations to different light environments.

What techniques are most effective for assessing the functional integrity of recombinant Photosystem Q(B) protein?

To effectively assess the functional integrity of recombinant Photosystem Q(B) protein from Secale cereale, researchers should employ a multi-parametric approach that examines both structural integrity and functional activity:

  • Spectroscopic Assessment:

    • Chlorophyll fluorescence induction analysis to evaluate electron transport capacity

    • Fluorescence emission spectra measurements at varying excitation wavelengths (440 nm and 470 nm)

    • Absorption spectroscopy to verify proper pigment binding and protein folding

  • Biochemical Assays:

    • Oxygen evolution measurements using artificial electron acceptors

    • Hill reaction assays to assess electron transport capacity

    • Binding assays with quinone molecules to verify QB binding site functionality

  • Protein Quality Analysis:

    • SDS-PAGE with densitometry to assess purity (>90% purity is recommended)

    • Size-exclusion chromatography to evaluate oligomeric state and aggregation

    • Circular dichroism to confirm proper secondary structure elements

  • Thermal Stability Assessment:

    • Differential scanning calorimetry to determine protein thermal stability

    • Temperature-dependent activity assays to assess functional thermostability

    • Thermal shift assays to evaluate cofactor binding effects on stability

  • Functional Reconstitution:

    • Reconstitution into liposomes or nanodiscs to assess membrane integration

    • Electron paramagnetic resonance (EPR) spectroscopy to evaluate redox cofactor binding

    • Flash-induced absorption spectroscopy to measure electron transfer kinetics

These techniques should be performed under standardized conditions, with appropriate positive controls (such as native thylakoid membrane preparations) to benchmark the functional properties of the recombinant protein .

What are the applications of recombinant Secale cereale Photosystem Q(B) protein in crop improvement research?

Recombinant Secale cereale Photosystem Q(B) protein serves as a valuable research tool in several crop improvement applications:

  • Photosynthetic Efficiency Enhancement:

    • Structure-function studies to identify amino acid residues that could be modified to improve electron transport efficiency

    • Development of crops with enhanced carbon fixation capabilities through directed evolution of the D1 protein

    • Comparative analysis with D1 proteins from high-yielding crop varieties to identify beneficial variations

  • Stress Tolerance Development:

    • Investigation of mutations that confer tolerance to abiotic stresses such as drought, salinity, and high light

    • Engineering variants with improved repair mechanisms to reduce photoinhibition under stress conditions

    • Screening for variants with enhanced stability under fluctuating environmental conditions

  • Herbicide Resistance Breeding:

    • Structure-based design of herbicide-resistant variants for crop protection strategies

    • Development of selective markers for plant transformation based on modified D1 proteins

    • Screening of natural variants for herbicide resistance traits

  • Biofortification Strategies:

    • Modification of photosynthetic efficiency to enhance nutrient uptake and utilization

    • Engineering variants that optimize energy allocation toward desired metabolic pathways

  • Climate Adaptation Research:

    • Development of D1 protein variants adapted to anticipated future climate conditions

    • Screening for temperature-resilient variants to address climate change challenges

The University of Florida's Plant Breeding Ph.D. program highlights how research on photosystem proteins contributes to developing crops with improved productivity and stress tolerance, addressing global food security challenges .

What methodological challenges exist in expressing and purifying functional Photosystem Q(B) protein?

Researchers face several significant methodological challenges when expressing and purifying functional Photosystem Q(B) protein from Secale cereale:

  • Membrane Protein Solubility Issues:

    • The hydrophobic nature of transmembrane domains complicates expression in aqueous environments

    • Requires careful selection of detergents and solubilization conditions

    • Potential for protein aggregation during extraction and purification

  • Proper Folding Constraints:

    • Achieving native conformation in heterologous expression systems is challenging

    • E. coli lacks chloroplast-specific chaperones needed for optimal folding

    • Misfolding can result in inclusion body formation requiring refolding protocols

  • Cofactor Incorporation Difficulties:

    • Proper binding of chlorophyll, pheophytin, and quinone molecules is essential for function

    • Heterologous systems may lack necessary cofactors or assembly machinery

    • Reconstitution of cofactors may be required post-purification

  • Stability Concerns:

    • The protein is prone to degradation during purification procedures

    • Light sensitivity requires handling under specific illumination conditions

    • Need for appropriate protease inhibitors and antioxidants during purification

  • Functional Assessment Complexities:

    • Assessing electron transfer requires reconstitution into membrane systems

    • Difficult to distinguish between properly folded and misfolded protein populations

    • Requires specialized equipment for functional analysis

  • Storage Challenges:

    • Repeated freeze-thaw cycles significantly reduce protein activity

    • Need for cryoprotectants like trehalose (6%) and glycerol (50%)

    • Optimal pH and buffer conditions must be maintained to prevent denaturation

To address these challenges, researchers often employ specialized expression systems, membrane-mimetic environments (nanodiscs, liposomes), and gentle purification techniques combined with rapid functional assessment protocols .

What is the role of the chloroplast genome in expressing native Photosystem Q(B) protein in Secale cereale?

The chloroplast genome plays a fundamental role in the expression and regulation of native Photosystem Q(B) protein (D1 protein) in Secale cereale through several key mechanisms:

  • Genetic Organization:

    • The psbA gene encoding the D1 protein is located in the large single copy (LSC) region of the chloroplast genome

    • The Secale cereale chloroplast genome is 137,042 bp in length with the LSC region spanning 81,060 bp

    • The gene structure lacks introns, facilitating efficient translation in the chloroplast environment

  • Transcriptional Regulation:

    • The psbA gene possesses chloroplast-specific promoter elements that respond to light and developmental cues

    • Transcription is mediated by a plastid-encoded RNA polymerase and nuclear-encoded sigma factors

    • Expression levels are tightly regulated in response to environmental conditions and developmental stage

  • Post-transcriptional Processing:

    • The chloroplast genome encodes RNA processing machinery specific for chloroplast transcripts

    • The psbA mRNA undergoes 5' and 3' end processing and may be subject to RNA editing

    • Translation is regulated by RNA-binding proteins that respond to light conditions

  • Co-localization Benefits:

    • Co-localization of the gene with its site of function enables rapid response to photodamage

    • The chloroplast genetic system allows for high expression levels of this abundant protein

    • Proximity to assembly factors facilitates incorporation into the photosystem complex

  • Evolutionary Conservation:

    • The chloroplast genome structure is highly conserved across Poaceae family members

    • The psbA gene shows high sequence conservation, reflecting its essential function

    • SSR (Simple Sequence Repeat) analysis reveals conservation patterns around the psbA locus

The chloroplast genetic system provides a specialized environment for the efficient expression and assembly of the Photosystem Q(B) protein, ensuring proper integration into the thylakoid membrane and association with other photosystem components .

How do post-translational modifications affect Photosystem Q(B) protein function?

Post-translational modifications (PTMs) play crucial roles in regulating the function, turnover, and repair of the Photosystem Q(B) protein (D1 protein) in Secale cereale:

  • Phosphorylation:

    • The N-terminal threonine residues undergo light-dependent phosphorylation

    • Phosphorylation regulates the migration of PSII complexes between grana and stroma lamellae during the PSII repair cycle

    • This modification is critical for protection against photoinhibition under high light conditions

  • Oxidative Modifications:

    • The D1 protein is highly susceptible to oxidative damage due to its role in electron transport

    • Specific amino acid residues (particularly D1-208 tyrosine and nearby tryptophan residues) undergo oxidative modifications

    • These modifications serve as signals for D1 protein degradation and replacement

  • N-terminal Processing:

    • The precursor D1 protein undergoes N-terminal processing during integration into the thylakoid membrane

    • This processing is essential for proper assembly of the PSII complex

    • The processed N-terminus is involved in interactions with other PSII subunits

  • C-terminal Processing:

    • The C-terminus undergoes proteolytic processing by the CtpA protease

    • This processing is essential for the assembly of the oxygen-evolving complex

    • Improper processing results in non-functional PSII complexes

  • Turnover Regulation:

    • The D1 protein has the highest turnover rate among photosystem proteins

    • PTMs mark damaged D1 protein for degradation by FtsH and Deg proteases

    • This rapid turnover and replacement cycle is essential for maintaining photosynthetic efficiency

These post-translational modifications create a dynamic regulatory system that allows plants to maintain photosynthetic efficiency under varying environmental conditions and to rapidly repair photodamage, which is particularly important under stress conditions such as those caused by heavy metal exposure .

How can researchers analyze the impact of environmental stressors on Photosystem Q(B) protein function?

Researchers can employ a comprehensive suite of analytical methods to assess how environmental stressors affect Photosystem Q(B) protein function in Secale cereale:

  • Chlorophyll Fluorescence Analysis:

    • Pulse-amplitude modulation (PAM) fluorometry to measure photochemical (qP) and non-photochemical quenching (qN) parameters

    • Fast chlorophyll fluorescence induction kinetics (OJIP test) to assess electron transport efficiency

    • Fv/Fm measurements to quantify maximum quantum efficiency of PSII

    • Time-resolved fluorescence spectroscopy to analyze energy transfer kinetics

  • Spectroscopic Methods:

    • Absorption spectroscopy to monitor changes in pigment-protein interactions (440 nm and 470 nm)

    • Fluorescence emission spectroscopy to assess relative contributions from different photosystem components

    • Circular dichroism to detect stress-induced conformational changes

  • Biochemical Analyses:

    • Non-denaturing gel electrophoresis to assess changes in oligomeric states of LHCII complexes

    • Quantification of photosynthetic pigments (chlorophyll a, chlorophyll b, carotenoids)

    • Immunoblotting with anti-D1 antibodies to monitor protein degradation and turnover

    • Turnover rate measurements using isotope labeling

  • Molecular Biology Approaches:

    • Quantitative RT-PCR to measure stress-induced changes in psbA gene expression

    • RNA-seq to analyze transcriptome-wide responses

    • Analysis of post-translational modifications using mass spectrometry

  • Biophysical Measurements:

    • Electron paramagnetic resonance (EPR) spectroscopy to probe redox-active cofactors

    • Oxygen evolution measurements to assess water-splitting activity

    • Thermoluminescence to evaluate charge recombination events

The impact of abiotic stressors such as lead (Pb²⁺) exposure can be comprehensively evaluated using these techniques. For example, research has shown that Pb²⁺ exposure at concentrations of 2-5 mM causes significant alterations in photosystem organization, leading to increased non-photochemical quenching and decreased photosynthetic efficiency in Secale cereale .

What protein-protein interactions are critical for Photosystem Q(B) protein functionality?

The Photosystem Q(B) protein (D1) functions as part of a complex network of protein-protein interactions that are essential for its proper integration, stability, and function within Photosystem II:

  • Core Complex Interactions:

    • D1-D2 heterodimer: Forms the reaction center core that binds essential cofactors

    • D1-CP43 and D1-CP47: Interactions critical for light harvesting and energy transfer

    • D1-cytochrome b559: Essential for photoprotection and assembly

    • D1-PsbI: Stabilizes the reaction center and influences electron transfer kinetics

  • Oxygen-Evolving Complex Interactions:

    • D1-PsbO: Stabilizes the manganese cluster and maintains optimal calcium and chloride concentrations

    • D1-PsbP and D1-PsbQ: Optimize oxygen evolution and protect the manganese cluster

    • C-terminal domain interactions with the manganese cluster: Critical for water oxidation

  • Light-Harvesting Complex Interactions:

    • D1-LHCII connections: Mediated through CP43 and CP47 antenna proteins

    • Dynamic associations affected by phosphorylation state and light conditions

    • Reorganization of these interactions under stress conditions (e.g., lead exposure increases LHCII oligomerization)

  • Assembly and Repair Interactions:

    • D1-FtsH protease: Facilitates damaged D1 removal during repair cycle

    • D1-Deg proteases: Initial cleavage of damaged D1 protein

    • D1-D1 protease (CtpA): Processes C-terminus during assembly

    • D1-assembly factors (including Ycf48, Psb27, Psb28): Guide proper integration and assembly

  • Electron Transport Chain Interactions:

    • D1-plastoquinone binding: QB pocket accommodates mobile electron carrier

    • D1-iron-bicarbonate complex: Mediates electron transfer between QA and QB

    • D1-YZ tyrosine residue: Electron transfer intermediate between manganese cluster and P680+

These protein-protein interactions create a dynamic network that allows for efficient light harvesting, electron transport, and rapid repair of photodamage. Alterations in these interactions, as observed under stress conditions like heavy metal exposure, directly impact photosynthetic efficiency .

How do molecular breeding techniques utilize knowledge of Photosystem Q(B) protein genetics?

Molecular breeding programs leverage detailed knowledge of Photosystem Q(B) protein genetics to develop crops with enhanced photosynthetic efficiency, stress tolerance, and agricultural performance:

  • Marker-Assisted Selection (MAS):

    • Development of molecular markers linked to beneficial psbA alleles

    • Selection for naturally occurring variants with improved photosynthetic efficiency

    • Tracking introgression of favorable psbA alleles from wild relatives into elite cultivars

    • Screening for herbicide resistance mutations in the psbA gene

  • TILLING (Targeting Induced Local Lesions IN Genomes):

    • Identification of induced mutations in the psbA gene that confer improved traits

    • Screening for variants with enhanced temperature stability or stress tolerance

    • Selection of mutations that optimize electron transport efficiency

  • Genome Editing Technologies:

    • CRISPR/Cas9-mediated precise editing of the psbA gene

    • Introduction of specific amino acid substitutions that enhance protein stability

    • Engineering herbicide resistance through targeted modifications of the QB binding pocket

    • Chloroplast transformation for direct modification of the psbA gene in its native genomic context

  • Genomic Selection:

    • Incorporation of psbA variants into prediction models for photosynthetic efficiency

    • Selection based on genomic estimated breeding values that incorporate photosystem gene data

    • Development of breeding indices that include photosynthetic performance metrics

  • Comparative Genomics Applications:

    • Identification of beneficial psbA alleles from related species with enhanced stress tolerance

    • Analysis of natural variation in psbA sequences across diverse Secale germplasm

    • Integration of chloroplast genome data with nuclear genome information for comprehensive breeding strategies

The University of Florida's Plant Breeding Ph.D. program emphasizes the integration of traditional breeding approaches with molecular techniques to develop improved crop varieties. This integrated curriculum prepares breeders to leverage knowledge of photosystem genetics for crop improvement, supporting the development of varieties with enhanced productivity and stress resilience .

What are the latest advancements in structural characterization of Photosystem Q(B) protein from cereals?

Recent advances in structural characterization of Photosystem Q(B) (D1) protein from cereal crops like Secale cereale have significantly enhanced our understanding of its function and potential for improvement:

  • High-Resolution Structural Analysis:

    • Cryo-electron microscopy has enabled near-atomic resolution structures of cereal PSII complexes

    • Identification of cereal-specific amino acid variations in the QB binding pocket

    • Detailed mapping of lipid-protein interactions that stabilize the D1 protein within the thylakoid membrane

    • Visualization of water channels critical for the oxygen-evolving complex function

  • Time-Resolved Structural Studies:

    • Serial femtosecond crystallography using X-ray free-electron lasers to capture intermediate states of electron transfer

    • Structural insights into the dynamics of QB binding during photosynthetic electron transport

    • Visualization of structural changes during the S-state transitions of water oxidation

  • Advanced Spectroscopic Techniques:

    • Solid-state NMR studies revealing dynamic aspects of the D1 protein within the membrane environment

    • EPR spectroscopy identifying subtle differences in electron transfer kinetics between cereal variants

    • Two-dimensional electronic spectroscopy providing insights into energy transfer pathways

  • Computational Approaches:

    • Molecular dynamics simulations of cereal D1 proteins under various environmental conditions

    • Quantum mechanics/molecular mechanics (QM/MM) calculations of electron transfer processes

    • Homology modeling combined with machine learning approaches to predict functional consequences of sequence variations

  • Integrative Structural Biology:

    • Combination of multiple structural techniques (X-ray crystallography, cryo-EM, SAXS, NMR)

    • Integration of structural data with functional assays to correlate structure with photosynthetic efficiency

    • Comparative structural analysis between stress-tolerant and stress-sensitive cereal varieties

These advanced structural studies have provided unprecedented insights into the molecular architecture of cereal Photosystem II complexes, revealing subtle structural differences that may contribute to variations in photosynthetic efficiency, stress tolerance, and herbicide sensitivity among different cereal species and varieties .

What are the emerging research frontiers for Photosystem Q(B) protein in crop improvement?

Emerging research frontiers for Photosystem Q(B) protein in crop improvement represent exciting opportunities at the intersection of molecular biology, structural biology, and agricultural innovation:

  • Climate Resilience Engineering:

    • Development of D1 protein variants with enhanced stability under temperature extremes

    • Engineering of photoprotection mechanisms to improve performance under drought and high light

    • Identification of natural D1 variants from stress-tolerant wild relatives for crop improvement

    • Creation of synthetic variants with optimized performance under predicted future climate conditions

  • Photosynthetic Efficiency Enhancement:

    • Engineering of D1 proteins with altered redox potentials to optimize electron transfer rates

    • Modification of the QB binding pocket to enhance plastoquinone exchange rates

    • Development of variants with reduced susceptibility to photoinhibition

    • Creation of synthetic D1 variants that expand the spectral range of light utilization

  • Advanced Genome Editing Applications:

    • Precision editing of the chloroplast genome to introduce beneficial D1 mutations

    • Development of base editing approaches for targeted modification of the psbA gene

    • Creation of chloroplast-specific CRISPR systems for precise editing of photosystem genes

    • Engineering of synthetic regulatory elements to optimize D1 expression patterns

  • Systems Biology Integration:

    • Multi-omics approaches linking D1 variants to whole-plant performance metrics

    • Integration of structural biology with field performance under varying environmental conditions

    • Network modeling to understand interactions between nuclear and chloroplast genomes

    • Development of predictive models for photosynthetic performance based on D1 sequence variants

  • Translational Research Applications:

    • Development of high-throughput phenotyping methods for photosynthetic efficiency

    • Establishment of breeding programs specifically targeting photosynthetic improvement

    • Creation of crop varieties with optimized D1 proteins for specific agricultural environments

    • Implementation of precision agriculture approaches based on photosynthetic efficiency metrics

These emerging frontiers represent areas where fundamental research on the Photosystem Q(B) protein can be translated into practical applications for sustainable agriculture and food security, addressing challenges related to climate change, population growth, and resource limitations .

What are recommended protocols for troubleshooting recombinant Photosystem Q(B) protein expression?

When encountering challenges with recombinant Photosystem Q(B) protein expression from Secale cereale, researchers should implement the following systematic troubleshooting protocols:

  • Expression System Optimization:

    • Test multiple E. coli strains specialized for membrane protein expression (C41, C43, Lemo21)

    • Evaluate different induction conditions (temperature, IPTG concentration, induction time)

    • Consider alternative expression systems (insect cells, cell-free systems) for improved folding

    • Experiment with various promoter strengths to balance expression level with proper folding

  • Solubilization and Extraction Optimization:

    • Screen multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Test different buffer compositions (pH, salt concentration, stabilizing additives)

    • Evaluate mild solubilization conditions to maintain protein integrity

    • Consider native-like membrane mimetics (nanodiscs, SMALPs) for extraction

  • Protein Folding Enhancement:

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J-GrpE)

    • Include chlorophyll or chlorophyll analogs during expression/purification

    • Test expression at lower temperatures (16-20°C) to promote proper folding

    • Consider fusion tags that enhance solubility (MBP, SUMO) with appropriate proteases

  • Purification Optimization:

    • Implement gentle purification conditions (low pressure, reduced flow rates)

    • Include stabilizing agents (glycerol, trehalose, specific lipids)

    • Test different affinity tag positions (N-terminal vs. C-terminal)

    • Consider on-column refolding protocols for proteins recovered from inclusion bodies

  • Protein Quality Assessment:

    • Verify protein identity by mass spectrometry

    • Assess protein homogeneity by size-exclusion chromatography

    • Evaluate secondary structure by circular dichroism

    • Test functional activity using electron transfer assays

  • Storage and Stability Optimization:

    • Evaluate different storage buffers (pH, ionic strength, additives)

    • Test various cryoprotectants (glycerol, sucrose, trehalose)

    • Compare lyophilization protocols with different excipients

    • Determine optimal storage temperature (-20°C vs. -80°C)

When reconstituting lyophilized protein, researchers should aim for a final concentration of 0.1-1.0 mg/mL in an appropriate buffer with 6% trehalose for stability. Addition of glycerol to 50% final concentration is recommended for long-term storage, with aliquoting to avoid freeze-thaw cycles .

How can comparative genomics advance our understanding of Photosystem Q(B) protein evolution in crops?

Comparative genomics approaches offer powerful insights into the evolution and functional diversification of Photosystem Q(B) protein across crop species, revealing adaptation mechanisms that can inform crop improvement strategies:

  • Evolutionary Conservation Analysis:

    • Sequence conservation mapping across diverse plant lineages reveals functionally critical residues

    • Identification of cereal-specific sequence signatures in the psbA gene

    • Analysis of selection pressures on different functional domains of the D1 protein

    • Correlation between sequence conservation patterns and structural elements

  • Chloroplast Genome Comparative Studies:

    • The psbA gene in Secale cereale is located in the large single copy (LSC) region of the 137,042 bp chloroplast genome

    • Comparative analysis of gene synteny and organization across the Poaceae family

    • Examination of repeat sequences and SSRs (Simple Sequence Repeats) in proximity to the psbA gene

    • Analysis of regulatory element evolution in chloroplast genomes

  • Adaptive Evolution Investigation:

    • Identification of positively selected sites in the D1 protein across environmental gradients

    • Correlation of sequence variations with habitat-specific adaptations

    • Analysis of convergent evolution in photosystem proteins across distantly related species

    • Identification of sequence variations associated with stress tolerance

  • Pan-genome Analysis:

    • Characterization of psbA variants across diverse germplasm collections

    • Identification of rare alleles with potential adaptive significance

    • Analysis of chloroplast haplotype diversity within and between crop species

    • Association of haplotype variation with photosynthetic efficiency traits

  • Phylogenomic Applications:

    • Reconstruction of evolutionary relationships based on chloroplast genome sequences

    • Analysis of horizontal gene transfer events involving photosystem genes

    • Dating of evolutionary events in photosystem protein evolution

    • Correlation of major evolutionary transitions with environmental changes

Secale cereale shows close phylogenetic relationships with other Triticeae species based on chloroplast genome analysis, with the psbA gene showing high sequence conservation reflecting its essential function in photosynthesis. Comparative genomic approaches reveal subtle sequence variations that may contribute to differences in photosynthetic efficiency, stress tolerance, and environmental adaptation across cereal crops .

What are the best practices for designing experiments to study Photosystem Q(B) protein function in crop species?

Designing robust experiments to study Photosystem Q(B) protein function in crop species requires careful consideration of multiple factors to ensure meaningful and reproducible results:

  • Experimental Design Principles:

    • Implement randomized complete block designs with adequate biological replicates (minimum n=3)

    • Include appropriate positive and negative controls for all assays

    • Conduct power analyses to determine sample sizes needed for statistical significance

    • Design factorial experiments to assess interaction effects between variables

    • Include time-course measurements to capture dynamic responses

  • Growth Condition Standardization:

    • Maintain precisely controlled growth conditions (light intensity, photoperiod, temperature, humidity)

    • Use growth chambers with programmable parameters for reproducibility

    • Document all environmental parameters throughout experiments

    • Apply treatments at standardized developmental stages

    • Consider field validation of key findings from controlled environments

  • Physiological Measurements:

    • Implement non-destructive chlorophyll fluorescence measurements to track photosystem function

    • Standardize leaf sampling protocols (position, age, time of day)

    • Use multiple complementary techniques to assess photosynthetic parameters

    • Include whole-plant performance metrics to correlate with molecular data

    • Standardize light adaptation periods before measurements

  • Molecular Analysis Approaches:

    • Implement optimized protocols for chloroplast isolation from specific tissues

    • Use quantitative approaches for protein abundance determination

    • Employ multiple antibodies targeting different epitopes for verification

    • Include time-course analyses for dynamic processes (protein turnover, repair)

    • Implement controls for tissue-specific and developmental stage variations

  • Data Integration Strategies:

    • Correlate molecular-level measurements with physiological responses

    • Implement statistical approaches appropriate for multi-level data integration

    • Use multivariate analyses to identify patterns across complex datasets

    • Develop predictive models connecting molecular variations to whole-plant phenotypes

    • Validate key findings across multiple growing seasons or environments

  • Reporting and Reproducibility Guidelines:

    • Document all experimental conditions in sufficient detail for reproduction

    • Provide raw data and analytical pipelines when publishing

    • Report both biological and technical variation

    • Follow FAIR (Findable, Accessible, Interoperable, Reusable) data principles

    • Implement standardized protocols across collaborative research networks

These best practices ensure that experiments investigating Photosystem Q(B) protein function generate robust, reproducible results that can be meaningfully interpreted and applied in crop improvement programs .

What are the recommended resources for researchers studying Photosystem Q(B) protein?

Researchers studying Photosystem Q(B) protein from Secale cereale and other cereal crops should utilize this comprehensive collection of resources:

  • Databases and Repositories:

    • UniProt (www.uniprot.org): Access protein sequences and annotations (e.g., A6YGB8 for related photosystem proteins)

    • Protein Data Bank (www.rcsb.org): Structural information on photosystem complexes

    • Chloroplast DB (chloroplast.ocean.washington.edu): Chloroplast genome sequences and annotations

    • Plant Reactome (plantreactome.gramene.org): Photosynthesis pathway information

    • Gramene (www.gramene.org): Comparative genomics platform for cereals

  • Specialized Software Tools:

    • PyMOL/Chimera: Visualization and analysis of protein structures

    • MEGA/PAML: Evolutionary analysis of sequence data

    • ChloroP/TargetP: Prediction of chloroplast transit peptides

    • PRABI-Doua tools: Analysis of membrane protein topologies

    • PAM (Photosynthesis Analyzer for Microcomputers): Chlorophyll fluorescence analysis

  • Experimental Protocols and Methods:

    • Plant Physiology Methods: Comprehensive protocols for photosynthesis measurements

    • Current Protocols in Protein Science: Techniques for membrane protein expression and purification

    • Methods in Enzymology (Photosynthesis and Respiration volumes): Specialized photosynthesis assays

    • Cold Spring Harbor Protocols: Chloroplast isolation and fractionation techniques

    • Plant Cell Physiology protocols: Specialized techniques for photosystem analysis

  • Commercial Resources:

    • Recombinant proteins: Available from suppliers like Creative Biomart (catalog #RFL2430PF for related proteins)

    • Antibodies: Anti-D1 antibodies from Agrisera and other suppliers

    • Analytical equipment: PAM fluorometers from Walz, spectrophotometers from various suppliers

    • Chloroplast isolation kits: Available from Sigma-Aldrich and other suppliers

    • Detergents and lipids: Specialized suppliers for membrane protein work

  • Academic Training Programs:

    • University of Florida's Plant Breeding Ph.D. program and similar programs at other institutions

    • Specialized workshops on photosynthesis measurements and analysis

    • Online courses in structural biology and membrane protein analysis

    • Professional development workshops at major plant biology conferences

These resources provide researchers with the necessary tools, databases, protocols, and materials to conduct comprehensive studies on Photosystem Q(B) protein structure, function, and applications in crop improvement .

What interdisciplinary approaches are recommended for advancing Photosystem Q(B) protein research?

Advancing Photosystem Q(B) protein research requires collaborative interdisciplinary approaches that integrate diverse expertise and methodologies:

  • Integration of Structural Biology and Biophysics:

    • Combine crystallography, cryo-EM, and spectroscopy for comprehensive structural insights

    • Apply advanced biophysical techniques (EPR, NMR, ultrafast spectroscopy) to study electron transfer dynamics

    • Implement computational modeling to connect structural features with functional properties

    • Develop structure-based approaches for rational protein engineering

  • Molecular Biology and Genomics Collaboration:

    • Integrate chloroplast genomics with nuclear genome analysis for comprehensive understanding

    • Apply CRISPR-based technologies for precise genome editing of photosystem genes

    • Implement high-throughput phenotyping approaches to assess photosynthetic performance

    • Develop marker systems for tracking beneficial psbA alleles in breeding programs

  • Plant Physiology and Agronomy Integration:

    • Connect molecular-level studies with whole-plant physiology measurements

    • Implement field trials to validate laboratory findings under agricultural conditions

    • Develop phenotyping protocols that bridge molecular mechanisms with crop performance

    • Create predictive models connecting D1 protein variants with agronomic traits

  • Computational and Systems Biology Approaches:

    • Develop multi-scale models connecting molecular dynamics to whole-plant physiology

    • Implement machine learning approaches to identify patterns in complex photosynthetic data

    • Create predictive models for photosynthetic efficiency based on D1 sequence variations

    • Apply network analysis to understand interactions between photosystem components

  • Translational Research Collaborations:

    • Establish academic-industry partnerships to accelerate application of research findings

    • Develop interdisciplinary training programs like the University of Florida's Plant Breeding Ph.D.

    • Create collaborative networks spanning basic research to agricultural implementation

    • Establish standardized protocols for assessing photosynthetic improvements in breeding programs

  • Technology Development Partnerships:

    • Collaborate with engineers to develop improved instrumentation for photosynthesis measurements

    • Partner with computational scientists to develop specialized software tools

    • Engage with agricultural technology companies to implement findings in crop improvement

    • Work with biotechnology companies to develop optimized expression systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.