Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993 (SELMODRAFT_117993)

Shipped with Ice Packs
In Stock

Description

Molecular Identification of Recombinant Selaginella moellendorffii CASP-like Protein SELMODRAFT_117993

The recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993 (Uniprot ID: D8SJ65) is a transmembrane protein encoded by the gene SELMODRAFT_117993. It belongs to the CASP-like (CASPL) family, which shares structural and functional homology with the MARVEL protein family . Key molecular features include:

AttributeDetails
Protein NameCASP-like protein 2U4 (SmCASPL2U4)
Gene NameSELMODRAFT_117993
SpeciesSelaginella moellendorffii (spikemoss), a lycophyte model organism
Sequence LengthPartial (1–191 amino acids) or full-length (varies by product)
Transmembrane DomainsFour predicted transmembrane regions
MARVEL DomainConserved residues in transmembrane domains align with MARVEL family

Amino Acid Sequence (Partial)

The N-terminal sequence (residues 1–50) includes:
MGAYDGAEAPRAAPASTAANSRPSRLLLLHSLLLRLVAVVLSILVIAVMVHAKQRVMIFK .

  • Tags: Affinity tags (e.g., His-tag) are added during production but not explicitly listed in product data .

  • Stability: Avoid repeated freeze-thaw cycles; short-term storage at 4°C is acceptable .

  • Reconstitution: Recommended in deionized water with 5–50% glycerol for long-term storage .

Role in Plant Cell Biology

  1. Evolutionary Distinction: Lycophytes like S. moellendorffii may utilize CASPLs for distinct functions compared to flowering plants.

  2. Membrane Domain Formation: CASPL transmembrane domains are conserved, implying a role in membrane organization, even without EL1-mediated targeting .

Comparative Expression Patterns

While direct expression data for SELMODRAFT_117993 is limited, broader studies on S. moellendorffii highlight:

  • Tissue-Specific Genes: Lignin biosynthesis genes (e.g., p-coumarate 3-hydroxylase) show high expression in stems and roots, aligning with vascular development .

  • Stress Responses: CASP-like genes in rice and Arabidopsis are induced under ion stress, suggesting potential roles in environmental adaptation .

Experimental Uses

This recombinant protein serves as a tool for:

  1. Structural Studies: Investigating transmembrane domain interactions and scaffold formation.

  2. Functional Assays: Testing membrane localization and interactions with peroxidases or lignin precursors.

  3. Evolutionary Analyses: Comparing CASPL functions across land plant lineages.

Research Gaps

  • Expression Localization: No data on tissue-specific expression of SELMODRAFT_117993 in S. moellendorffii.

  • Functional Validation: Ectopic expression studies in heterologous systems are needed to confirm membrane domain formation.

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges will apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
SELMODRAFT_117993; CASP-like protein 2U4; SmCASPL2U4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Selaginella moellendorffii (Spikemoss)
Target Names
SELMODRAFT_117993
Target Protein Sequence
MGAYDGAEAPRAAPASTAANSRPSRLLLLHSLLLRLVAVVLSILVIAVMVHAKQRVMIFK AEWDNSKAFVALVTISAICLGYSFLQFILSAFHLCSKSWKSPTKCWAWMNFIADQILTYA MLGAAAAAAELAYIAKNGSSRAQWQPICSTFNTFCTRAGASIILSFIAVLALANSSAISA YHLFRRPSSSV
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993?

Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993 is a partial recombinant protein derived from the spikemoss Selaginella moellendorffii. It is produced in mammalian cell systems and identified by UniProt accession number D8SJ65 . The protein belongs to the CASP-like family, which typically includes proteins involved in membrane barrier formation in plants.

When working with this protein, researchers should note that the commercially available form is partial rather than full-length, which may impact functional studies depending on which domains are present. The expression in mammalian cells may also confer certain post-translational modifications that could be important for the protein's structure and function in experimental settings.

How does SELMODRAFT_117993 compare structurally to other CASP-like proteins from Selaginella moellendorffii?

When examining CASP-like proteins from Selaginella moellendorffii, researchers can compare SELMODRAFT_117993 with related proteins such as SELMODRAFT_431321. A comparative analysis reveals significant differences that may influence experimental design decisions:

FeatureSELMODRAFT_117993SELMODRAFT_431321
UniProt IDD8SJ65P0DH67
Protein LengthPartial (undefined)Full length (204 aa)
Expression SystemMammalian cellE. coli
Purity>85% (SDS-PAGE)>90% (SDS-PAGE)
Tag InformationVariable (determined during manufacturing)His-tag (N-terminal)
Alternative NamesNot specifiedCASP-like protein 2U1; SmCASPL2U1

These differences are critical to consider when designing comparative studies or selecting the appropriate protein for specific experimental questions. The expression system difference (mammalian versus bacterial) may particularly impact post-translational modifications and folding characteristics, potentially affecting functional studies .

What are the optimal storage conditions for maintaining SELMODRAFT_117993 stability?

The stability of SELMODRAFT_117993 is influenced by multiple factors including formulation, temperature, and handling practices. For optimal results, implement the following methodological approach:

For long-term storage:

  • Store lyophilized protein at -20°C/-80°C, where it maintains stability for approximately 12 months

  • Store protein in liquid form at -20°C/-80°C, with an expected shelf life of approximately 6 months

  • Add glycerol to a final concentration of 5-50% (manufacturer recommends 50%) when preparing aliquots for freezing

For routine laboratory use:

  • Maintain working aliquots at 4°C for no longer than one week

  • Strictly avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Document storage conditions and duration for each aliquot to maintain experimental reproducibility

When designing long-term experiments, researchers should prepare multiple small aliquots rather than repeatedly accessing a single stock, as this practice significantly extends the functional lifespan of the protein preparation.

What is the recommended reconstitution protocol for SELMODRAFT_117993?

For optimal reconstitution of SELMODRAFT_117993, follow this step-by-step methodological approach:

  • Briefly centrifuge the vial prior to opening to ensure all protein content collects at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • For improved stability, add glycerol to a final concentration of 5-50% (manufacturer default recommendation is 50%)

  • Prepare multiple small-volume aliquots to minimize freeze-thaw cycles

  • Store reconstituted protein according to the temperature guidelines outlined previously

When designing experiments sensitive to buffer components, researchers should consider that the presence of glycerol may affect certain assays, particularly those involving hydrophobic interactions or membrane systems. If necessary, dialysis or buffer exchange methods can be employed, though additional protein loss should be accounted for in experimental planning.

How can researchers utilize SELMODRAFT_117993 in structural biology studies?

To leverage SELMODRAFT_117993 in structural biology research, consider implementing the following methodological approaches:

  • Computational structure prediction:

    • Apply advanced deep learning methods similar to those demonstrated in CASP14, where prediction accuracy has reached near-experimental levels for many proteins

    • Use both template-based and template-free modeling approaches depending on the availability of structural homologs

    • Validate computational models through experimental techniques such as circular dichroism

  • Experimental structure determination:

    • Optimize protein concentration and buffer conditions for crystallization trials

    • Consider membrane-mimetic environments if transmembrane domains are present

    • Implement sparse matrix screening approaches to identify initial crystallization conditions

  • Structure-function relationship studies:

    • Map conserved residues onto predicted or determined structures

    • Design site-directed mutagenesis experiments targeting predicted functional domains

    • Correlate structural features with biological activities in functional assays

The recent advancements in protein structure prediction highlighted in CASP14, where GDT_TS scores above 90 were achieved for many targets, provide particularly promising avenues for structural characterization of proteins like SELMODRAFT_117993 .

What techniques are most effective for studying SELMODRAFT_117993 interactions with other proteins?

For investigating SELMODRAFT_117993 interactions with other proteins, implement a multi-technique approach:

  • In vitro binding assays:

    • Pull-down assays using immobilized SELMODRAFT_117993

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Microscale thermophoresis (MST) for measuring interactions in solution

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Computational prediction methods:

    • Leverage advances in protein structure prediction demonstrated in CASP14 to model protein complexes

    • Apply protein-protein docking algorithms to predict interaction interfaces

    • Use molecular dynamics simulations to assess complex stability

  • Cellular interaction studies:

    • Co-immunoprecipitation from plant cell extracts expressing tagged versions

    • Proximity labeling techniques such as BioID or APEX

    • Fluorescence resonance energy transfer (FRET) for detecting interactions in cellular contexts

When designing these experiments, carefully consider the partial nature of commercial SELMODRAFT_117993 preparations, as missing domains may affect interaction capabilities . Additionally, implementation of appropriate negative controls using unrelated proteins with similar biochemical properties is essential for distinguishing specific from non-specific interactions.

How can researchers design experiments to investigate the membrane-association properties of SELMODRAFT_117993?

To characterize the membrane-association properties of SELMODRAFT_117993, implement the following experimental strategy:

  • Membrane binding assays:

    • Liposome flotation assays using synthetic lipid vesicles of defined composition

    • Monolayer insertion experiments to measure surface pressure changes

    • Fluorescently labeled protein for direct visualization of membrane association

    • Fractionation of cellular components following expression in heterologous systems

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure changes upon membrane interaction

    • Infrared spectroscopy to analyze protein orientation in membranes

    • Atomic force microscopy to visualize protein arrangement on membrane surfaces

  • Computational analysis:

    • Hydropathy plotting and transmembrane domain prediction

    • Molecular dynamics simulations of protein-membrane interactions

    • Integration of structural predictions from approaches similar to those in CASP14

When designing these experiments, researchers should systematically vary membrane composition to identify specific lipid requirements for binding, and implement appropriate controls including heat-denatured protein and unrelated proteins with similar physicochemical properties.

What approaches are recommended for comparative functional studies between SELMODRAFT_117993 and homologous proteins from other plant species?

For rigorous comparative functional studies, implement this methodological framework:

  • Sequence-structure-function analysis:

    • Perform comprehensive multiple sequence alignment of CASP-like proteins across diverse plant lineages

    • Identify conserved motifs and species-specific variations

    • Apply homology modeling or deep learning approaches similar to those in CASP14 to predict structural conservation

    • Map sequence conservation onto structural models to identify functionally important regions

  • Heterologous expression systems:

    • Express SELMODRAFT_117993 and homologs in the same expression system to minimize system-specific effects

    • Create chimeric proteins by domain swapping to identify functional domains

    • Develop standardized functional assays applicable across homologs

  • Plant-based functional studies:

    • Complementation assays in mutant backgrounds

    • Ectopic expression with fluorescent tags to compare subcellular localization

    • CRISPR-Cas9 gene editing to create comparable mutations across species

When designing these comparative studies, researchers should carefully consider differences in expression systems between commercially available proteins (e.g., mammalian cell-expressed SELMODRAFT_117993 versus E. coli-expressed SELMODRAFT_431321) and standardize production methods when possible for direct comparisons .

How can researchers apply the latest protein structure prediction techniques to SELMODRAFT_117993?

To leverage cutting-edge structure prediction approaches for SELMODRAFT_117993, implement this advanced methodology:

  • Deep learning-based structure prediction:

    • Apply methods similar to those demonstrated in CASP14, where AlphaFold2 achieved unprecedented accuracy

    • Utilize multiple algorithms and compare predictions to increase confidence

    • Integrate predictions with available experimental data such as circular dichroism spectra

  • Model evaluation and refinement:

    • Assess prediction confidence through metrics such as GDT_TS scoring

    • Apply molecular dynamics simulations for structural refinement

    • Validate models through prediction of biochemical properties that can be experimentally tested

  • Functional interpretation:

    • Identify potential binding sites and functional domains within the predicted structure

    • Map evolutionary conservation onto structural models

    • Design validation experiments based on structural predictions

The exceptional accuracy demonstrated in CASP14, where GDT_TS scores above 85 were achieved even for difficult targets, suggests that modern computational approaches can provide highly reliable structural models for proteins like SELMODRAFT_117993 . The CASP (Critical Assessment of Structure Prediction) community experiment has shown that deep learning methods now rival experimental structures in accuracy for many proteins.

What biophysical techniques are most appropriate for validating predicted structures of SELMODRAFT_117993?

For experimental validation of SELMODRAFT_117993 structural predictions, implement a multi-technique approach:

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to verify secondary structure content

    • Fourier-transform infrared spectroscopy (FTIR) for complementary secondary structure analysis

    • Intrinsic fluorescence spectroscopy to probe tertiary structure organization

  • Hydrodynamic techniques:

    • Size-exclusion chromatography to determine Stokes radius

    • Analytical ultracentrifugation to assess shape and oligomeric state

    • Dynamic light scattering for particle size distribution

  • Limited proteolysis:

    • Identify protected regions corresponding to structured domains

    • Map proteolytic fragments to regions in the predicted structure

    • Compare experimental results with accessibility predictions from structural models

  • Cross-linking mass spectrometry:

    • Identify residues in spatial proximity through chemical cross-linking

    • Compare experimental cross-links with distances in predicted models

    • Use results to validate or refine computational predictions

When implementing these validation approaches, researchers should consider that partial protein preparations may provide incomplete structural information , and interpretation should account for the specific regions present in the commercial protein.

What are common challenges in experimental applications of SELMODRAFT_117993 and how can they be systematically addressed?

When working with SELMODRAFT_117993 in research settings, several challenges may arise. Address these methodically as follows:

  • Protein instability and degradation:

    • Implement strict temperature control during all handling steps

    • Add protease inhibitor cocktails to working solutions

    • Monitor protein integrity via SDS-PAGE before critical experiments

    • Minimize freeze-thaw cycles by preparing appropriately sized aliquots

  • Inconsistent activity in functional assays:

    • Establish quality control benchmarks before experimental use

    • Standardize protein quantification methods

    • Include internal standards and positive controls in each experiment

    • Document batch information and correlate with experimental outcomes

  • Buffer incompatibility issues:

    • Test protein stability in assay-specific buffers before experiments

    • Perform gradual buffer exchange rather than direct dilution into incompatible buffers

    • Consider the impact of glycerol concentration on specific assays

  • Aggregation during storage or experiment:

    • Monitor solution clarity visually and by dynamic light scattering

    • Centrifuge samples before use to remove potential aggregates

    • Optimize protein concentration for specific applications

Maintaining detailed records of troubleshooting steps and outcomes creates an invaluable resource for optimizing future experiments and contributes to reproducible research practices.

How should researchers design appropriate controls for functional studies with SELMODRAFT_117993?

Robust experimental design for SELMODRAFT_117993 functional studies requires comprehensive controls:

  • Negative controls:

    • Heat-denatured SELMODRAFT_117993 to control for non-specific effects

    • Buffer-only conditions to establish baseline measurements

    • Unrelated proteins with similar physical properties to distinguish specific from non-specific effects

  • Positive controls:

    • Well-characterized related proteins when available

    • Synthetic peptides corresponding to known functional domains

    • Activity controls appropriate for the specific assay being performed

  • Specificity controls:

    • Concentration-dependent responses to establish specificity

    • Competitive inhibition experiments

    • Antibody neutralization if applicable

  • Validation controls:

    • Multiple detection methods for confirming key findings

    • Technical replicates to assess methodological variability

    • Biological replicates to account for sample-to-sample variation

When interpreting results, researchers should consider that the partial nature of commercial SELMODRAFT_117993 may limit certain functional activities if critical domains are absent. Correlation between structure prediction models and experimental outcomes can provide additional validation of observed effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.