The recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993 (Uniprot ID: D8SJ65) is a transmembrane protein encoded by the gene SELMODRAFT_117993. It belongs to the CASP-like (CASPL) family, which shares structural and functional homology with the MARVEL protein family . Key molecular features include:
| Attribute | Details |
|---|---|
| Protein Name | CASP-like protein 2U4 (SmCASPL2U4) |
| Gene Name | SELMODRAFT_117993 |
| Species | Selaginella moellendorffii (spikemoss), a lycophyte model organism |
| Sequence Length | Partial (1–191 amino acids) or full-length (varies by product) |
| Transmembrane Domains | Four predicted transmembrane regions |
| MARVEL Domain | Conserved residues in transmembrane domains align with MARVEL family |
The N-terminal sequence (residues 1–50) includes:
MGAYDGAEAPRAAPASTAANSRPSRLLLLHSLLLRLVAVVLSILVIAVMVHAKQRVMIFK .
Tags: Affinity tags (e.g., His-tag) are added during production but not explicitly listed in product data .
Stability: Avoid repeated freeze-thaw cycles; short-term storage at 4°C is acceptable .
Reconstitution: Recommended in deionized water with 5–50% glycerol for long-term storage .
Evolutionary Distinction: Lycophytes like S. moellendorffii may utilize CASPLs for distinct functions compared to flowering plants.
Membrane Domain Formation: CASPL transmembrane domains are conserved, implying a role in membrane organization, even without EL1-mediated targeting .
While direct expression data for SELMODRAFT_117993 is limited, broader studies on S. moellendorffii highlight:
Tissue-Specific Genes: Lignin biosynthesis genes (e.g., p-coumarate 3-hydroxylase) show high expression in stems and roots, aligning with vascular development .
Stress Responses: CASP-like genes in rice and Arabidopsis are induced under ion stress, suggesting potential roles in environmental adaptation .
This recombinant protein serves as a tool for:
Structural Studies: Investigating transmembrane domain interactions and scaffold formation.
Functional Assays: Testing membrane localization and interactions with peroxidases or lignin precursors.
Evolutionary Analyses: Comparing CASPL functions across land plant lineages.
Expression Localization: No data on tissue-specific expression of SELMODRAFT_117993 in S. moellendorffii.
Functional Validation: Ectopic expression studies in heterologous systems are needed to confirm membrane domain formation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges will apply for dry ice shipping.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
KEGG: smo:SELMODRAFT_117993
Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_117993 is a partial recombinant protein derived from the spikemoss Selaginella moellendorffii. It is produced in mammalian cell systems and identified by UniProt accession number D8SJ65 . The protein belongs to the CASP-like family, which typically includes proteins involved in membrane barrier formation in plants.
When working with this protein, researchers should note that the commercially available form is partial rather than full-length, which may impact functional studies depending on which domains are present. The expression in mammalian cells may also confer certain post-translational modifications that could be important for the protein's structure and function in experimental settings.
When examining CASP-like proteins from Selaginella moellendorffii, researchers can compare SELMODRAFT_117993 with related proteins such as SELMODRAFT_431321. A comparative analysis reveals significant differences that may influence experimental design decisions:
| Feature | SELMODRAFT_117993 | SELMODRAFT_431321 |
|---|---|---|
| UniProt ID | D8SJ65 | P0DH67 |
| Protein Length | Partial (undefined) | Full length (204 aa) |
| Expression System | Mammalian cell | E. coli |
| Purity | >85% (SDS-PAGE) | >90% (SDS-PAGE) |
| Tag Information | Variable (determined during manufacturing) | His-tag (N-terminal) |
| Alternative Names | Not specified | CASP-like protein 2U1; SmCASPL2U1 |
These differences are critical to consider when designing comparative studies or selecting the appropriate protein for specific experimental questions. The expression system difference (mammalian versus bacterial) may particularly impact post-translational modifications and folding characteristics, potentially affecting functional studies .
The stability of SELMODRAFT_117993 is influenced by multiple factors including formulation, temperature, and handling practices. For optimal results, implement the following methodological approach:
For long-term storage:
Store lyophilized protein at -20°C/-80°C, where it maintains stability for approximately 12 months
Store protein in liquid form at -20°C/-80°C, with an expected shelf life of approximately 6 months
Add glycerol to a final concentration of 5-50% (manufacturer recommends 50%) when preparing aliquots for freezing
For routine laboratory use:
Maintain working aliquots at 4°C for no longer than one week
Strictly avoid repeated freeze-thaw cycles as they significantly compromise protein integrity
Document storage conditions and duration for each aliquot to maintain experimental reproducibility
When designing long-term experiments, researchers should prepare multiple small aliquots rather than repeatedly accessing a single stock, as this practice significantly extends the functional lifespan of the protein preparation.
For optimal reconstitution of SELMODRAFT_117993, follow this step-by-step methodological approach:
Briefly centrifuge the vial prior to opening to ensure all protein content collects at the bottom
Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL
For improved stability, add glycerol to a final concentration of 5-50% (manufacturer default recommendation is 50%)
Prepare multiple small-volume aliquots to minimize freeze-thaw cycles
Store reconstituted protein according to the temperature guidelines outlined previously
When designing experiments sensitive to buffer components, researchers should consider that the presence of glycerol may affect certain assays, particularly those involving hydrophobic interactions or membrane systems. If necessary, dialysis or buffer exchange methods can be employed, though additional protein loss should be accounted for in experimental planning.
To leverage SELMODRAFT_117993 in structural biology research, consider implementing the following methodological approaches:
Computational structure prediction:
Apply advanced deep learning methods similar to those demonstrated in CASP14, where prediction accuracy has reached near-experimental levels for many proteins
Use both template-based and template-free modeling approaches depending on the availability of structural homologs
Validate computational models through experimental techniques such as circular dichroism
Experimental structure determination:
Optimize protein concentration and buffer conditions for crystallization trials
Consider membrane-mimetic environments if transmembrane domains are present
Implement sparse matrix screening approaches to identify initial crystallization conditions
Structure-function relationship studies:
Map conserved residues onto predicted or determined structures
Design site-directed mutagenesis experiments targeting predicted functional domains
Correlate structural features with biological activities in functional assays
The recent advancements in protein structure prediction highlighted in CASP14, where GDT_TS scores above 90 were achieved for many targets, provide particularly promising avenues for structural characterization of proteins like SELMODRAFT_117993 .
For investigating SELMODRAFT_117993 interactions with other proteins, implement a multi-technique approach:
In vitro binding assays:
Pull-down assays using immobilized SELMODRAFT_117993
Surface plasmon resonance (SPR) for quantitative binding kinetics
Microscale thermophoresis (MST) for measuring interactions in solution
Isothermal titration calorimetry (ITC) for thermodynamic parameters
Computational prediction methods:
Cellular interaction studies:
Co-immunoprecipitation from plant cell extracts expressing tagged versions
Proximity labeling techniques such as BioID or APEX
Fluorescence resonance energy transfer (FRET) for detecting interactions in cellular contexts
When designing these experiments, carefully consider the partial nature of commercial SELMODRAFT_117993 preparations, as missing domains may affect interaction capabilities . Additionally, implementation of appropriate negative controls using unrelated proteins with similar biochemical properties is essential for distinguishing specific from non-specific interactions.
To characterize the membrane-association properties of SELMODRAFT_117993, implement the following experimental strategy:
Membrane binding assays:
Liposome flotation assays using synthetic lipid vesicles of defined composition
Monolayer insertion experiments to measure surface pressure changes
Fluorescently labeled protein for direct visualization of membrane association
Fractionation of cellular components following expression in heterologous systems
Biophysical characterization:
Circular dichroism (CD) spectroscopy to assess secondary structure changes upon membrane interaction
Infrared spectroscopy to analyze protein orientation in membranes
Atomic force microscopy to visualize protein arrangement on membrane surfaces
Computational analysis:
When designing these experiments, researchers should systematically vary membrane composition to identify specific lipid requirements for binding, and implement appropriate controls including heat-denatured protein and unrelated proteins with similar physicochemical properties.
For rigorous comparative functional studies, implement this methodological framework:
Sequence-structure-function analysis:
Perform comprehensive multiple sequence alignment of CASP-like proteins across diverse plant lineages
Identify conserved motifs and species-specific variations
Apply homology modeling or deep learning approaches similar to those in CASP14 to predict structural conservation
Map sequence conservation onto structural models to identify functionally important regions
Heterologous expression systems:
Express SELMODRAFT_117993 and homologs in the same expression system to minimize system-specific effects
Create chimeric proteins by domain swapping to identify functional domains
Develop standardized functional assays applicable across homologs
Plant-based functional studies:
Complementation assays in mutant backgrounds
Ectopic expression with fluorescent tags to compare subcellular localization
CRISPR-Cas9 gene editing to create comparable mutations across species
When designing these comparative studies, researchers should carefully consider differences in expression systems between commercially available proteins (e.g., mammalian cell-expressed SELMODRAFT_117993 versus E. coli-expressed SELMODRAFT_431321) and standardize production methods when possible for direct comparisons .
To leverage cutting-edge structure prediction approaches for SELMODRAFT_117993, implement this advanced methodology:
Deep learning-based structure prediction:
Model evaluation and refinement:
Functional interpretation:
Identify potential binding sites and functional domains within the predicted structure
Map evolutionary conservation onto structural models
Design validation experiments based on structural predictions
The exceptional accuracy demonstrated in CASP14, where GDT_TS scores above 85 were achieved even for difficult targets, suggests that modern computational approaches can provide highly reliable structural models for proteins like SELMODRAFT_117993 . The CASP (Critical Assessment of Structure Prediction) community experiment has shown that deep learning methods now rival experimental structures in accuracy for many proteins.
For experimental validation of SELMODRAFT_117993 structural predictions, implement a multi-technique approach:
Spectroscopic methods:
Circular dichroism (CD) spectroscopy to verify secondary structure content
Fourier-transform infrared spectroscopy (FTIR) for complementary secondary structure analysis
Intrinsic fluorescence spectroscopy to probe tertiary structure organization
Hydrodynamic techniques:
Size-exclusion chromatography to determine Stokes radius
Analytical ultracentrifugation to assess shape and oligomeric state
Dynamic light scattering for particle size distribution
Limited proteolysis:
Identify protected regions corresponding to structured domains
Map proteolytic fragments to regions in the predicted structure
Compare experimental results with accessibility predictions from structural models
Cross-linking mass spectrometry:
Identify residues in spatial proximity through chemical cross-linking
Compare experimental cross-links with distances in predicted models
Use results to validate or refine computational predictions
When implementing these validation approaches, researchers should consider that partial protein preparations may provide incomplete structural information , and interpretation should account for the specific regions present in the commercial protein.
When working with SELMODRAFT_117993 in research settings, several challenges may arise. Address these methodically as follows:
Protein instability and degradation:
Inconsistent activity in functional assays:
Establish quality control benchmarks before experimental use
Standardize protein quantification methods
Include internal standards and positive controls in each experiment
Document batch information and correlate with experimental outcomes
Buffer incompatibility issues:
Aggregation during storage or experiment:
Monitor solution clarity visually and by dynamic light scattering
Centrifuge samples before use to remove potential aggregates
Optimize protein concentration for specific applications
Maintaining detailed records of troubleshooting steps and outcomes creates an invaluable resource for optimizing future experiments and contributes to reproducible research practices.
Robust experimental design for SELMODRAFT_117993 functional studies requires comprehensive controls:
Negative controls:
Heat-denatured SELMODRAFT_117993 to control for non-specific effects
Buffer-only conditions to establish baseline measurements
Unrelated proteins with similar physical properties to distinguish specific from non-specific effects
Positive controls:
Well-characterized related proteins when available
Synthetic peptides corresponding to known functional domains
Activity controls appropriate for the specific assay being performed
Specificity controls:
Concentration-dependent responses to establish specificity
Competitive inhibition experiments
Antibody neutralization if applicable
Validation controls:
Multiple detection methods for confirming key findings
Technical replicates to assess methodological variability
Biological replicates to account for sample-to-sample variation
When interpreting results, researchers should consider that the partial nature of commercial SELMODRAFT_117993 may limit certain functional activities if critical domains are absent. Correlation between structure prediction models and experimental outcomes can provide additional validation of observed effects.