Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_272089 (SELMODRAFT_272089)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Recombinant Production

SELMODRAFT_272089 is commercially available in multiple recombinant forms, enabling diverse experimental applications:

Table 2: Recombinant Expression Systems for SELMODRAFT_272089

Host SystemCodeConjugate/ModificationSource
YeastCSB-YP517154SYF1Unmodified
E. coliCSB-EP517154SYF1Unmodified
E. coliCSB-EP517154SYF1-BBiotinylated (AviTag-BirA system)
BaculovirusCSB-BP517154SYF1Unmodified
Mammalian cellsCSB-MP517154SYF1Unmodified

Biotinylated versions (e.g., CSB-EP517154SYF1-B) facilitate protein interaction studies, leveraging the AviTag-BirA system for site-specific biotinylation .

Functional Hypotheses and Research Gaps

While direct functional data for SELMODRAFT_272089 is unavailable, its classification as a CASPL suggests potential roles:

  1. Membrane Scaffolding: Like angiosperm CASPs, it may form diffusion barriers in specialized membrane domains .

  2. Cell Wall Modification: Interaction with peroxidases or lignin polymerases, analogous to CASP-mediated Casparian strip formation .

Key Challenges:

  • Lack of EL1 Signature: Unlike angiosperm CASPs, S. moellendorffii CASPLs (including SELMODRAFT_272089) lack the conserved EL1 motif, suggesting divergent functional specializations .

  • Evolutionary Context: The absence of Casparian strips in lycophytes raises questions about the ancestral functions of CASPLs .

Identifiers and Cross-Referencing

DatabaseIdentifierLink/DescriptionSource
KEGGsmo:SELMODRAFT_272089Genome annotation
STRING88036.EFJ09182Protein interaction network
UniProtNot explicitly listed(See D8SJ65 for related CASP-like)

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SELMODRAFT_272089; CASP-like protein 2U6; SmCASPL2U6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Selaginella moellendorffii (Spikemoss)
Target Names
SELMODRAFT_272089
Target Protein Sequence
MSEHRIPVAADKKISPPISAGEQKGCKGLKRTDLMLRFAAFVCCTVTMVVLITDKQTSAI QVPGFNNLTITKTVSFDLAKAFVYLVSAAGIGAGYTLLVLVLSIISAERSKAIAWFIFVF DQLITYVLLAAAAASTEVAYMGAHAPPEASWLKVCSLFGRFCHQLGASLVTSLISTVLFA FSAAISAYYLFSNTNVRPAYSKG
Uniprot No.

Target Background

Database Links
Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_272089?

For optimal research outcomes, Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_272089 should be stored in Tris-based buffer with 50% glycerol (optimized for this specific protein) at -20°C . For extended storage periods, conservation at -80°C is recommended to maintain protein stability and activity .

Researchers should avoid repeated freeze-thaw cycles as this can significantly compromise protein integrity . For ongoing experiments, working aliquots can be maintained at 4°C for up to one week to minimize degradation while allowing convenient access . When handling the protein for experimental procedures, it's advisable to thaw aliquots on ice and maintain cold chain conditions during experimental setup to preserve structural integrity and functional properties.

How does SELMODRAFT_272089 relate to other CASP-like proteins taxonomically?

SELMODRAFT_272089 belongs to the broader family of CASP-like (CASPL) proteins, which have been identified across all major divisions of land plants as well as in green algae . Phylogenetic analysis reveals that CASPLs share evolutionary relationships with MARVEL protein family members found outside the plant kingdom .

Within the plant kingdom, CASPLs represent an ancient protein family that evolved before the emergence of Casparian strips in plant tissues . The SELMODRAFT_272089 from Selaginella moellendorffii (a lycophyte) represents an interesting evolutionary position, as Selaginella is among the earliest diverging vascular plants still extant today. Comparative analysis of CASPL proteins across species demonstrates conservation of key transmembrane domains, while the emergence of CASP-specific signatures correlates with the evolutionary appearance of Casparian strips in plants .

What experimental approaches can be used to investigate SELMODRAFT_272089 membrane localization and scaffold formation?

Investigating the membrane localization and scaffold-forming properties of SELMODRAFT_272089 requires a multi-faceted experimental approach:

  • Fluorescent protein fusion constructs: Creating fusion proteins with fluorescent tags (e.g., GFP or mCherry) allows for real-time visualization of protein localization in living cells. Based on methodologies used for other CASP proteins, researchers should construct both N- and C-terminal fusions to determine which preserves native localization .

  • Site-directed mutagenesis: Targeted mutation of conserved residues, particularly those in transmembrane domains, can help identify amino acids critical for proper localization. For instance, mutations in residues shared among most CASPLs (such as C168, F174, C175, G158, and W164 in AtCASP1) affected protein localization to varying degrees, with W164G showing the strongest effect .

  • Heterologous expression systems: Expression in model systems such as Arabidopsis endodermis can determine whether SELMODRAFT_272089 can integrate into the CASP membrane domain, as has been demonstrated for other CASPLs .

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can assess the mobility and turnover rate of the protein within the membrane, as CASP proteins typically show extremely low turnover in their membrane domains .

  • Co-immunoprecipitation: To identify interaction partners that may facilitate scaffold formation or subsequent cell wall modifications, particularly with enzymes involved in lignin deposition .

How can researchers experimentally determine the functional role of SELMODRAFT_272089 in directing cell wall modifications?

To investigate the role of SELMODRAFT_272089 in cell wall modifications, researchers should consider the following experimental design:

  • In vitro protein-protein interaction assays: Test interactions between SELMODRAFT_272089 and cell wall modification enzymes such as peroxidases involved in lignin polymerization, using techniques such as yeast two-hybrid, split-GFP, or pull-down assays .

  • Heterologous expression with cell wall staining: Express SELMODRAFT_272089 in model plants and use histochemical stains (e.g., lignin-specific stains like phloroglucinol-HCl) to detect changes in cell wall composition at sites of protein localization .

  • Genetic complementation studies: Test whether SELMODRAFT_272089 can functionally complement CASP mutants in Arabidopsis, particularly focusing on restoration of Casparian strip formation and associated barrier functions .

  • Domain swapping experiments: Create chimeric proteins between SELMODRAFT_272089 and known CASPs to determine which domains are necessary and sufficient for directing specific cell wall modifications .

  • Transmission electron microscopy: Use TEM to visualize ultrastructural changes in cell walls associated with SELMODRAFT_272089 expression and localization, with particular attention to the formation of localized cell wall thickenings or modifications .

What are the predicted functional differences between SELMODRAFT_272089 and other characterized CASP/CASPL proteins?

Based on sequence analysis and evolutionary relationships, several functional differences can be predicted between SELMODRAFT_272089 and other characterized CASP/CASPL proteins:

  • Evolutionary context: As a protein from Selaginella moellendorffii, SELMODRAFT_272089 represents an early-diverging vascular plant lineage, potentially retaining ancestral functions that may differ from those in angiosperms .

  • Transmembrane domain conservation: Analysis of conserved residues in transmembrane domains suggests that while the scaffold-forming capability is likely preserved, specific protein-protein interactions might differ, potentially leading to recruitment of different cell wall modification enzymes .

  • Expression pattern variation: Unlike endodermis-specific expression of many CASPs in Arabidopsis, SELMODRAFT_272089 may have a different tissue-specific expression pattern reflecting the simpler tissue organization of Selaginella moellendorffii .

  • Diffusion barrier formation: SELMODRAFT_272089 may contribute to formation of a membrane diffusion barrier with different properties compared to those formed by characterized CASPs, potentially allowing selective passage of different molecules .

  • Cell wall modification specificity: The specific type of cell wall modification directed by SELMODRAFT_272089 may differ from lignin deposition seen with characterized CASPs, potentially involving different cell wall polymers more prevalent in early land plants .

What purification methods are recommended for isolating SELMODRAFT_272089 for functional studies?

For isolating functional SELMODRAFT_272089 protein, the following purification methodology is recommended:

How should researchers approach experimental validation of SELMODRAFT_272089 interactions with other cellular components?

To systematically validate SELMODRAFT_272089 interactions with other cellular components, researchers should implement this multi-step validation approach:

  • Bioinformatic prediction:
    a. Use protein-protein interaction prediction tools (e.g., STRING, PRISM)
    b. Perform co-expression analysis across available Selaginella transcriptome datasets
    c. Identify potential interaction partners based on known CASP/CASPL interactors

  • In vitro interaction validation:
    a. Yeast two-hybrid (Y2H) screening with cDNA libraries from Selaginella tissues
    b. Pull-down assays using purified recombinant SELMODRAFT_272089 as bait
    c. Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for quantitative binding analysis

  • Cellular co-localization studies:
    a. Co-express fluorescently tagged SELMODRAFT_272089 with candidate interactors
    b. Perform high-resolution confocal microscopy to assess spatial overlap
    c. Implement FRET/FLIM techniques to confirm direct interactions in living cells

  • Functional validation:
    a. Design co-immunoprecipitation experiments from native or heterologous expression systems
    b. Conduct split-ubiquitin membrane yeast two-hybrid for membrane protein interactions
    c. Perform bimolecular fluorescence complementation (BiFC) in planta

  • Genetic approaches:
    a. Generate knockout/knockdown lines in model organisms expressing SELMODRAFT_272089
    b. Assess phenotypic changes when potential interactors are absent
    c. Conduct epistasis analysis with mutants of predicted interaction partners

A key consideration is to use appropriate controls, including SELMODRAFT_272089 with mutations in conserved residues that may disrupt specific interactions, as demonstrated for residues like W164 in AtCASP1 .

What molecular dynamics simulation parameters are appropriate for studying SELMODRAFT_272089 membrane integration?

For effective molecular dynamics (MD) simulations of SELMODRAFT_272089 membrane integration, researchers should consider the following specialized parameters and approach:

  • System preparation:
    a. Generate a 3D structural model using homology modeling based on related CASP proteins
    b. Embed the protein in a lipid bilayer that mimics the plant plasma membrane composition (typically POPC:POPE:Sitosterol in 6:2:2 ratio)
    c. Solvate the system with explicit water molecules and add counterions to neutralize the system

  • Force field selection:
    a. CHARMM36 or AMBER force fields optimized for membrane proteins
    b. Lipid14 parameters for accurate lipid bilayer dynamics
    c. TIP3P water model for solvation

  • Simulation parameters:
    a. Initial minimization: 5,000 steps of steepest descent followed by 5,000 steps of conjugate gradient
    b. Equilibration: Multi-stage equilibration (50 ns) with gradual release of positional restraints
    c. Production run: Minimum 500 ns simulation at 310K (37°C) and 1 atm pressure
    d. Periodic boundary conditions in all dimensions
    e. Particle Mesh Ewald (PME) for long-range electrostatics
    f. 2 fs time step with SHAKE algorithm for hydrogen bonds

  • Analysis focus:
    a. Protein stability and conformational changes (RMSD, RMSF)
    b. Transmembrane domain tilt angles and membrane insertion depth
    c. Lipid-protein interactions, particularly with the conserved residues in transmembrane regions
    d. Formation of hydrogen bonds between protein and membrane components
    e. Potential oligomerization interfaces if multiple protein copies are simulated

  • Enhanced sampling techniques:
    a. Consider umbrella sampling to calculate free energy profiles for membrane insertion
    b. Implement replica exchange MD if energy barriers between conformational states need to be overcome
    c. Steered MD to investigate protein-membrane association pathways

Particular attention should be paid to the conserved residues in transmembrane domains that have been shown to be critical for localization in related CASP proteins, such as the equivalent residues to C168, F174, and W164 in AtCASP1 .

How does SELMODRAFT_272089 compare functionally to CASP proteins in Arabidopsis thaliana?

A systematic comparison between SELMODRAFT_272089 and Arabidopsis thaliana CASP proteins reveals several important functional distinctions and similarities:

FeatureSELMODRAFT_272089Arabidopsis CASP ProteinsImplications for Research
Membrane Domain FormationLikely forms stable membrane domains based on conserved transmembrane regionsForm highly stable Casparian strip membrane domain (CSD) with extremely low turnoverSimilar experimental approaches can be used, but domain dynamics may differ
Tissue SpecificityExpression pattern not fully characterized in SelaginellaPrimarily expressed in endodermisRequires tissue-specific expression analysis in Selaginella
Cell Wall ModificationPotential role in directing cell wall modificationsDirect lignin deposition at Casparian strips via interaction with peroxidasesMay interact with different cell wall modification enzymes
Barrier FunctionMay contribute to diffusion barriers in Selaginella tissuesCreate membrane diffusion barriers preventing movement of lipids and proteinsFunctional assays should assess barrier properties in heterologous systems
Evolutionary ContextFrom early-diverging vascular plantFrom advanced angiospermRepresents more ancestral function of CASP-like proteins
Interacting PartnersPredicted to interact with cell wall modification machineryInteract with NADPH oxidases, peroxidases, and ESB1May identify novel interacting partners unique to lycophytes
Critical ResiduesContains conserved residues in transmembrane domainsMutations in conserved residues (e.g., W164G) disrupt localizationMutagenesis studies should focus on equivalent conserved residues

When designing experiments to characterize SELMODRAFT_272089, researchers should consider these differences and adapt methodologies accordingly. For instance, when testing functional complementation, cell-type specific promoters may need to be used to target expression to the appropriate tissue context .

What insights can the study of SELMODRAFT_272089 provide about the evolution of CASP/CASPL proteins in land plants?

Studying SELMODRAFT_272089 offers unique evolutionary insights due to Selaginella's position as an early-diverging vascular plant:

  • Ancestral functions: SELMODRAFT_272089 likely represents a more ancestral state of CASP/CASPL proteins before the divergence of seed plants and may retain primitive functions that were later specialized or lost in angiosperms . Analysis of its functional properties can reveal which aspects of CASP/CASPL biology are conserved across 400+ million years of plant evolution.

  • Diversification patterns: Comparative analysis between SELMODRAFT_272089 and other CASP/CASPL proteins can illuminate how the gene family diversified across plant lineages . The emergence of CASP-specific signatures correlates with the appearance of Casparian strips, and Selaginella represents an intermediate evolutionary stage in this process.

  • Tissue barrier evolution: The presence of CASP-like proteins in Selaginella, which has a simpler tissue organization than angiosperms, provides insights into how membrane domain organization and tissue barriers co-evolved with increasing plant complexity . This can help reconstruct the stepwise evolution of sophisticated barrier structures like Casparian strips.

  • Membrane scaffold origins: By examining SELMODRAFT_272089's capacity to form membrane domains, researchers can understand the ancestral properties that predisposed CASP proteins to eventually develop specialized functions in membrane scaffold formation .

  • Conservation of critical domains: Analysis of sequence conservation between SELMODRAFT_272089 and angiosperm CASPs reveals which protein domains have remained unchanged through evolution, indicating functionally critical regions versus those that have undergone adaptive changes .

  • Pre-adaptation for lignification: Studying whether SELMODRAFT_272089 can direct lignin deposition may reveal how CASP proteins were pre-adapted for their role in Casparian strip formation before specialized endodermal barriers evolved .

How can contradictions in experimental findings about CASPL proteins be reconciled when studying SELMODRAFT_272089?

Researchers studying SELMODRAFT_272089 should be aware of several common contradictions in CASPL protein research and implement strategies to reconcile them:

  • Localization versus function discrepancies:

    • Contradiction: Some CASPLs localize to the correct membrane domain but fail to complement function.

    • Reconciliation approach: Distinguish between scaffold formation and recruitment of modification enzymes by performing both localization studies and functional complementation independently. Document partial complementation phenotypes thoroughly .

  • Conservation versus specificity paradox:

    • Contradiction: Despite high conservation in transmembrane domains, CASPLs show distinct localization patterns.

    • Reconciliation approach: Employ domain-swapping experiments to identify specific sequences conferring unique localization properties while acknowledging the importance of cellular context .

  • Expression pattern versus function relationship:

    • Contradiction: Similar CASPLs expressed in different tissues may have divergent functions.

    • Reconciliation approach: When characterizing SELMODRAFT_272089, document expression patterns comprehensively and correlate with subcellular localization in native context before inferring function .

  • Heterologous versus native system results:

    • Contradiction: Behavior in heterologous systems may not reflect native function.

    • Reconciliation approach: Always validate findings from heterologous expression by testing in as close to native context as possible. When using Arabidopsis as expression system, document limitations explicitly .

  • Structural prediction versus experimental observation:

    • Contradiction: Computational predictions of protein behavior may contradict experimental observations.

    • Reconciliation approach: Implement iterative refinement where experimental findings inform improved computational models and vice versa. Report confidence metrics for computational predictions .

  • Biochemical versus genetic evidence:

    • Contradiction: Protein interactions observed in vitro may not be relevant in vivo.

    • Reconciliation approach: Validate any protein interactions through multiple independent methods across different scales (from molecular to physiological) .

Researchers should document all experimental conditions extensively to allow proper comparison between studies, as differences in expression levels, tags, or cellular contexts can lead to apparently contradictory results.

How can SELMODRAFT_272089 be utilized in studies of membrane domain organization in plants?

SELMODRAFT_272089 represents a valuable tool for investigating fundamental aspects of membrane domain organization in plants:

  • Model system for primitive membrane domains: As a CASP-like protein from an early-diverging vascular plant, SELMODRAFT_272089 can serve as a model for studying the fundamental principles of membrane domain formation prior to the evolution of specialized structures like Casparian strips . This provides insights into the basic mechanisms of membrane compartmentalization in plants.

  • Domain-formation reporter system: Fluorescently tagged SELMODRAFT_272089 can be used as a reporter to identify and study membrane domains across different plant tissues and species . By observing its localization patterns, researchers can discover novel membrane domains that might have been previously uncharacterized.

  • Comparative membrane biology tool: Expression of SELMODRAFT_272089 in model plants allows direct comparison of membrane organization between lycophytes and angiosperms . This comparative approach can reveal both conserved and divergent aspects of membrane domain formation across evolutionary time.

  • Structure-function relationship studies: Through systematic mutagenesis of conserved residues, researchers can identify the minimal requirements for membrane domain formation using SELMODRAFT_272089 as a simplified model compared to more specialized CASP proteins .

  • Synthetic biology applications: The scaffold-forming properties of SELMODRAFT_272089 can potentially be exploited to engineer novel membrane domains with custom properties, creating spatially defined reaction centers within plant cell membranes . This has applications in metabolic engineering and the development of biosensors.

  • Lipid interaction studies: As a membrane domain-forming protein, SELMODRAFT_272089 can be used to investigate how proteins interact with specific lipid components to create specialized membrane environments, contributing to our understanding of lipid-protein interactions in plants .

What potential biotechnological applications might emerge from studying SELMODRAFT_272089?

Research on SELMODRAFT_272089 could lead to several innovative biotechnological applications:

  • Designer membrane domains: Understanding how SELMODRAFT_272089 forms stable membrane domains could enable the engineering of synthetic membrane scaffolds with novel properties . These could be used to anchor and organize enzyme complexes at specific cellular locations, enhancing metabolic pathway efficiency.

  • Cell wall modification tools: If SELMODRAFT_272089 directs specific cell wall modifications like other CASP proteins, it could be utilized as a tool to direct targeted changes to plant cell walls . This has potential applications in improving lignocellulosic biomass for biofuel production or enhancing crop lodging resistance.

  • Barrier enhancement in crops: Knowledge gained from SELMODRAFT_272089 about membrane barrier formation could inform strategies to enhance barrier properties in crop plants . This might improve water use efficiency, nutrient uptake control, or resistance to soil-borne pathogens.

  • Synthetic cellular compartmentalization: The membrane scaffold-forming ability of SELMODRAFT_272089 could be exploited to create novel subcellular compartments with specialized functions . This compartmentalization could segregate competing metabolic pathways or concentrate enzymes for improved productivity.

  • Protein localization systems: Fusion with domains from SELMODRAFT_272089 could provide a new method to target proteins to specific membrane domains . This localization system could be valuable for both research and applied biotechnology.

  • Stress response engineering: If SELMODRAFT_272089 is involved in stress responses in Selaginella (a genus known for desiccation tolerance), insights could lead to novel approaches for engineering stress tolerance in crops . The protein could potentially be used to modify membrane properties to enhance resilience to environmental stresses.

  • Biomedical research applications: Given that some Selaginella species show anticancer properties , understanding SELMODRAFT_272089 function might reveal novel mechanisms of action that could inspire pharmaceutical development approaches .

How might SELMODRAFT_272089 contribute to understanding broader questions about plant adaptation to terrestrial environments?

SELMODRAFT_272089 research offers significant insights into plant terrestrialization adaptations:

  • Evolution of water management systems: As a protein from Selaginella, one of the earliest vascular plant lineages to colonize land, SELMODRAFT_272089 may provide insights into the evolution of water conservation mechanisms that were critical for terrestrial adaptation . Understanding its role in membrane organization could illuminate how early vascular plants developed systems to control water movement.

  • Development of tissue specialization: The study of SELMODRAFT_272089 localization and function can reveal how membrane domain organization contributed to the emergence of specialized tissues in early land plants . This specialization was crucial for the development of complex plant bodies adapted to terrestrial environments.

  • Protection against environmental stressors: Selaginella species are known for their resilience to environmental stresses, including some with remarkable desiccation tolerance . Investigating whether SELMODRAFT_272089 contributes to stress responses could reveal ancient adaptive mechanisms for coping with the harsh conditions of terrestrial environments.

  • Root-like structure development: If SELMODRAFT_272089 functions in Selaginella's rhizophores (root-like structures), it may provide insights into the convergent evolution of water and nutrient uptake systems across different plant lineages . This is particularly relevant as root systems were crucial innovations for terrestrial plant success.

  • Cell wall evolution: The potential role of SELMODRAFT_272089 in directing cell wall modifications connects to the broader question of how plant cell walls evolved to provide both structural support and protection in a terrestrial setting . Cell wall adaptations were essential for plants to stand upright against gravity and resist desiccation.

  • Symbiotic relationships: Understanding membrane domain organization in early vascular plants like Selaginella could illuminate how plants developed the cellular machinery necessary for forming symbiotic relationships with fungi and bacteria, which were critical for nutrient acquisition in terrestrial environments .

  • Evolutionary conservation of barrier formation: By comparing SELMODRAFT_272089 function with barrier-forming proteins in other plant lineages, researchers can trace the evolutionary history of physiological barriers that regulate water and solute movement—a fundamental adaptation for terrestrial life .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.