Recombinant Selaginella uncinata Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

PsbA facilitates electron transfer between QA and QB plastoquinones in Photosystem II, enabling the generation of a proton gradient for ATP synthesis. Notably:

  • Herbicide Target: Binds triazine and urea-based herbicides, making it a critical subject in agricultural research .

  • Stability: Unlike other Selaginella chloroplast genes, psbA lacks RNA editing, suggesting evolutionary optimization for functional stability .

Genomic and Evolutionary Context

Selaginella uncinata’s plastid genome exhibits unique traits impacting psbA studies:

FeatureImplications for psbA
Accelerated MutationHigh substitution rates and low GC content (~28%)
Structural InstabilityLacks RecA1-mediated DNA repair, leading to repeat-driven rearrangements
RNA EditingAbsent in psbA mRNA, contrasting with >3,400 editing sites in other genes

These genomic peculiarities underscore challenges in maintaining psbA integrity and its suitability for studying plastid evolution .

Research Applications

  • Photosynthetic Mechanisms: Used to probe QB-site interactions and electron transport kinetics .

  • Herbicide Resistance: Serves as a model for engineering herbicide-tolerant crops .

  • Evolutionary Studies: Highlights adaptive strategies in lycophytes with primitive plastid genomes .

Comparative Insights

While Selaginella psbA shares functional homology with cyanobacterial homologs (e.g., Anacystis nidulans), its recombinant form lacks post-translational modifications seen in algae (e.g., Prorocentrum micans), simplifying in vitro studies .

Challenges and Future Directions

  • Production Limitations: Commercial availability is restricted, with no current sales listings .

  • Structural Studies: High-resolution crystallography is needed to resolve QB-binding dynamics.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Selaginella uncinata (Blue spike-moss) (Lycopodium uncinatum)
Target Names
psbA
Target Protein Sequence
MTATLERRENASLWGNFCDWITSTENRLYIGWFGVLMIPTLLTATSVFITAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This gradient is subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein (psbA) in Selaginella uncinata?

Photosystem Q(B) protein, also known as psbA or D1 protein, is a crucial 32 kDa thylakoid membrane protein integral to Photosystem II (PSII) function in Selaginella uncinata. This protein functions as a key component of the photosynthetic electron transport chain with the enzymatic classification EC 1.10.3.9 . As part of the PSII reaction center, psbA binds cofactors necessary for the initial charge separation events in photosynthesis and participates in the water-splitting process that generates molecular oxygen.

The protein from Selaginella uncinata (blue spikemoss or peacock spikemoss) has received particular attention due to the evolutionary divergence of Selaginellaceae plastomes, which show accelerated substitution rates and structural adaptations . Unlike many other photosynthetic organisms, Selaginella species exhibit unique plastome characteristics that may influence psbA function.

How does Selaginella uncinata compare to other Selaginella species in terms of evolutionary adaptation?

Selaginella uncinata belongs to the family Selaginellaceae, which exhibits remarkable evolutionary divergence in its plastid genomes. Studies on Selaginella species reveal several distinctive features:

CharacteristicS. uncinataOther Selaginella speciesTypical land plants
Plastome structureDynamic networkVariable network structureGenerally conserved
GC contentLowLowHigher
Substitution ratesAcceleratedAcceleratedLower
Repeat elementsAbundantAbundantFewer
Direct/Inverted repeatsAbsentAbsent in manyPresent
RecA1 (plastid)AbsentAbsentPresent
RecA3 (mitochondrial)AbsentAbsentPresent

The absence of plastid-targeted Recombinase A1 (RecA1) and mitochondrion-targeted RecA3 in Selaginella species, including S. uncinata, appears to correlate with increased genomic instability . Research suggests that the interplay between the deficient DNA-RRR (Recombination, Repair, and Replication) system and high repeat content has driven extraordinary divergence of Selaginella plastomes . This evolutionary context is essential for understanding the unique characteristics of S. uncinata psbA protein.

What are the optimal storage and handling conditions for recombinant Selaginella uncinata psbA protein?

For recombinant Selaginella uncinata psbA protein, the following storage and handling protocols are recommended:

  • Storage temperature: Store at -20°C for regular use; for extended storage, conserve at -20°C or -80°C .

  • Buffer composition: Maintain in Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Aliquot strategy: Working aliquots should be stored at 4°C for up to one week to minimize freeze-thaw cycles .

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended as it may compromise protein integrity .

These conditions are crucial for maintaining protein activity and structural integrity. Researchers should validate protein functionality after extended storage periods using activity assays specific to photosystem proteins.

What experimental designs are most appropriate for studying Selaginella uncinata psbA function?

When designing experiments to study recombinant Selaginella uncinata psbA function, several experimental approaches should be considered:

Single-Case Experimental Designs

Single-case experimental designs can be valuable when studying rare or unique specimens like Selaginella uncinata or when investigating specific functional aspects of the recombinant psbA protein. These designs typically involve:

  • Reversal design (A-B-A): This approach establishes baseline measurements (A), applies an experimental treatment (B), then returns to baseline conditions (A) . For example, measuring photosynthetic parameters before, during, and after exposure to specific inhibitors or environmental stressors.

  • Multiple-baseline design: This design is useful when comparing the psbA protein function across different conditions or between different domains of the protein simultaneously .

  • Changing-criterion design: This approach may be valuable when studying progressive effects of environmental factors on psbA function .

Quasi-Experimental Approaches

When randomization is not possible (as is often the case with specialized recombinant proteins), quasi-experimental designs can be employed:

  • One-group posttest-only design: While this is the simplest approach, it has significant limitations due to lack of control groups . It should only be used for preliminary investigations.

  • More robust quasi-experimental designs: These should include appropriate controls and multiple measurement points to establish causality between experimental manipulations and psbA function .

The selection of experimental design should be guided by research questions, available resources, and ethical considerations. When possible, incorporating repeated measurements and multiple comparison conditions will strengthen research findings.

How does the absence of RecA1 influence research approaches to studying Selaginella uncinata psbA?

The absence of plastid-targeted Recombinase A1 (RecA1) in Selaginella uncinata creates unique research considerations when studying its psbA protein. RecA1 is typically involved in the DNA-RRR (Recombination, Repair, and Replication) system, and its absence correlates with:

  • Accelerated substitution rates: The lack of RecA1 surveillance likely contributes to increased mutation rates in the plastome, including the psbA gene .

  • Structural instability: Without RecA1, repeat elements may trigger illegitimate recombination, affecting genomic stability .

  • Repeat accumulation: A large collection of short- and medium-sized repeats has been observed in Selaginella plastomes, potentially as a consequence of deficient DNA-RRR systems .

Research methodology implications include:

  • Comparative molecular evolution studies: Researchers should account for accelerated evolution rates when comparing S. uncinata psbA with orthologs from other species.

  • Structural analysis protocols: Additional validation steps may be needed when predicting protein structure due to potential increased divergence.

  • Functional complementation experiments: Testing whether introducing RecA1 affects psbA stability or function could provide insights into evolutionary adaptation mechanisms.

These considerations highlight how understanding the evolutionary context of Selaginella uncinata can inform experimental design and interpretation of results.

What analytical techniques are most effective for characterizing recombinant Selaginella uncinata psbA protein interactions?

For comprehensive characterization of recombinant Selaginella uncinata psbA protein interactions, a multi-technique approach is recommended:

Biophysical Characterization Methods

TechniqueApplicationAdvantagesLimitations
Circular Dichroism (CD)Secondary structure analysisNon-destructive, requires small sampleLimited structural resolution
Differential Scanning Calorimetry (DSC)Thermal stability analysisDirect measurement of unfolding transitionsRequires larger sample amounts
Surface Plasmon Resonance (SPR)Binding kinetics with interaction partnersReal-time, label-free detectionSurface immobilization may affect function
Isothermal Titration Calorimetry (ITC)Thermodynamics of binding interactionsDirect measurement of binding parametersHigher protein consumption
Native Mass SpectrometryComplex composition and stoichiometryMaintains non-covalent interactionsSpecialized equipment required

Functional Analysis Methods

  • Oxygen evolution measurements: Quantify the water-splitting activity associated with functional psbA protein.

  • Electron transport rate analysis: Determine how efficiently the recombinant protein supports photosynthetic electron transport.

  • Fluorescence-based assays: Measure chlorophyll fluorescence parameters as indicators of photosystem II function.

  • Cross-linking studies: Identify protein-protein interaction partners within the photosynthetic apparatus.

When designing these analyses, researchers should account for the unique evolutionary context of Selaginella uncinata, including its accelerated substitution rates and structural adaptations .

How can single-case experimental designs be optimized for studying rare photosynthetic proteins like Selaginella uncinata psbA?

When working with rare recombinant proteins like Selaginella uncinata psbA, optimization of single-case experimental designs is crucial:

  • Baseline stability assessment: Before implementing experimental manipulations, establish stable baseline measurements through repeated observations. This is particularly important for proteins from organisms with accelerated evolutionary rates like Selaginella .

  • Data collection frequency: Implement repeated measurements (at least three observations per experimental phase) to establish reliable patterns of protein behavior under varying conditions .

  • Individual analysis approach: Analyze data on a case-by-case basis rather than averaging across different experimental runs to detect subtle functional variations . This is illustrated in the following comparative data analysis approach:

Experimental RunBaseline ActivityTreatment ResponseChange
Run A70 units85 units+15 units
Run B50 units80 units+30 units
Run C66 units66 units0 units
Run D58 units83 units+25 units
Average61 units78.5 units+17.5 units

In this example, Run C shows no response to treatment, which would be masked in group analysis but reveals important information about variable protein functionality .

  • Phase reversal considerations: The traditional A-B-A reversal design may be modified for irreversible processes. When studying learning or adaptive responses in photosynthetic systems, consider using A-B-A-B design to end with the treatment phase .

These optimizations allow researchers to maximize information gained from limited samples of recombinant Selaginella uncinata psbA protein while maintaining scientific rigor.

How can researchers address the challenge of low homology between Selaginella uncinata psbA and model organism photosystem proteins?

The accelerated evolution observed in Selaginella plastomes creates challenges when comparing its psbA protein with those from model organisms . Researchers can implement the following methodological approaches:

  • Structure-based alignment strategies: Focus on conserved functional domains rather than sequence identity alone. The key functional regions of psbA tend to be more conserved despite sequence divergence.

  • Phylogenetically-informed comparative analysis: Use statistical methods that account for evolutionary distance when making functional predictions.

  • Combined experimental verification: Supplement computational predictions with experimental validation of protein function through:

    • Site-directed mutagenesis of conserved residues

    • Chimeric protein construction

    • Complementation assays in model systems

  • Structural prediction refinement: Employ multiple structural prediction algorithms and consensus approaches to improve accuracy when working with divergent sequences.

These approaches help bridge the gap between the unique evolutionary history of Selaginella uncinata and established knowledge from model photosynthetic organisms.

What considerations should guide research on the plastome network structure's influence on Selaginella uncinata psbA expression?

The dynamic network structure of Selaginella plastomes presents unique considerations for studying psbA expression :

  • Genomic context analysis: The arrangement of genes surrounding psbA may differ significantly from model organisms, potentially affecting transcriptional regulation.

  • Repeat element influence: The presence of pervasive repeat elements may create genomic instability that affects gene expression . Researchers should analyze:

    • Proximity of repeat elements to the psbA gene

    • Potential alternative promoters created by repeat insertions

    • RNA secondary structures influenced by repeat sequences

  • Transcriptome profiling approach: When analyzing psbA expression, consider:

    • Using multiple reference genes for qRT-PCR normalization

    • Implementing RNA-seq approaches with specialized assembly parameters

    • Validating transcript structures through targeted RT-PCR

  • Methodological validation: Standard protocols developed for model organisms may require optimization for Selaginella due to its unique plastome characteristics.

These considerations help researchers develop appropriate methodological approaches that account for the extraordinary genomic context of Selaginella uncinata psbA.

How might emerging single-molecule techniques advance understanding of Selaginella uncinata psbA function?

Emerging single-molecule techniques offer promising approaches to overcome challenges in studying recombinant Selaginella uncinata psbA:

  • Single-molecule FRET (smFRET): This technique can reveal dynamic conformational changes in psbA protein during function, providing insights into:

    • Protein folding pathways

    • Interaction dynamics with electron transport partners

    • Structural responses to environmental stressors

  • Atomic Force Microscopy (AFM): High-resolution AFM can characterize:

    • Topography of membrane-embedded psbA

    • Mechanical properties of protein domains

    • Force-dependent unfolding pathways

  • Single-molecule tracking: Fluorescently labeled psbA can be tracked to study:

    • Diffusion within membranes

    • Assembly kinetics into photosynthetic complexes

    • Turnover dynamics under varying conditions

  • Nanopore analysis: This approach can be used to study:

    • Protein translocation mechanisms

    • Unfolding pathways

    • Single-molecule electrophysiology

These single-molecule approaches are particularly valuable for proteins like Selaginella uncinata psbA that may exhibit functional heterogeneity due to their unique evolutionary history .

What research questions remain unanswered regarding the relationship between Selaginella uncinata psbA structure and its evolutionary divergence?

Several critical research questions remain to be addressed:

  • Structure-function relationship: How do the unique substitutions in Selaginella uncinata psbA affect its:

    • Electron transport efficiency

    • Susceptibility to photoinhibition

    • Interaction with other photosystem components

    • Repair and turnover dynamics

  • Evolutionary adaptation: What selective pressures drove the accelerated evolution of Selaginella plastomes and how do these adaptations benefit the organism in its ecological niche?

  • Cytonuclear integration: How has the co-evolution of nuclear and plastid genomes compensated for the deficient DNA-RRR system in Selaginella? This includes:

    • Potential nuclear-encoded factors that compensate for missing plastid functions

    • Alternative repair mechanisms that maintain plastome integrity

    • Regulatory adaptations that accommodate genomic instability

  • Functional consequences of repeat elements: How do the pervasive repeat elements in Selaginella plastomes influence psbA expression and function?

Addressing these questions will require integrated approaches combining structural biology, evolutionary analysis, functional biochemistry, and systems biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.