Recombinant Semliki forest virus Structural polyprotein

Shipped with Ice Packs
In Stock

Description

Polyprotein Processing Mechanisms

The recombinant polyprotein undergoes cotranslational and post-translational processing to yield functional viral proteins:

Key Cleavage Events

  1. Capsid Autoproteolysis

    • The capsid protein cleaves itself from the polyprotein during translation, requiring only 38 residues of the p62 sequence for efficient cleavage .

    • Mutation studies (e.g., serine-219 substitution) confirm capsid’s role as a serine protease .

  2. Signal Peptidase Activity

    • Host signal peptidase processes p62 and E1 transmembrane domains, enabling ER membrane insertion .

  3. Post-ER Modifications

    • p62 is cleaved into E2 by furin-like proteases in the Golgi, a prerequisite for viral infectivity .

    • E1 and E2 undergo host-specific glycosylation, with E1 glycans being more processed (complex-type in mammalian cells, paucimannose in insect cells) compared to E2’s conserved oligomannose structures .

Recombinant Expression Systems

To produce replication-deficient SFV particles, engineered helper RNAs encode the structural polyprotein under a subgenomic promoter :

Design Features

  • Two-Helper RNA System: Separates capsid and spike (p62-6K-E1) genes into distinct RNAs to minimize recombination risks .

  • Capsid Translational Enhancer: Optimizes expression levels of structural proteins .

  • Conditional Activation: Helper variants with mutated spike proteins require chymotrypsin treatment for infectivity, enhancing biosafety .

Functional Insights from Research

  • Membrane Translocation: The 6K peptide’s C-terminal 26 residues are essential for reinitiating E1 translocation after p62 synthesis .

  • Host Interactions: The capsid protein inhibits nonsense-mediated mRNA decay (NMD), facilitating viral RNA persistence in host cells .

  • Glycosylation Plasticity: E1’s glycome varies with host cell type, while E2’s structures are sterically constrained, impacting interspecies transmission .

Applications in Biotechnology

  • Vaccine Development: SFV vectors expressing cytokines (e.g., TNF-α, IFN-γ) or antigens enable high-yield immunogen production .

  • Gene Delivery: Replication-deficient particles efficiently transduce cells without producing progeny virions .

  • Membrane Protein Studies: The polyprotein’s cleavage mechanisms serve as a model for ER translocation and signal peptide analysis .

Challenges and Innovations

  • Genetic Stability: Duplication of nsP3 sequences in recombinant SFV leads to recombination-driven instability, necessitating optimized constructs .

  • Structural Resolution: Cryo-EM and glycomic profiling have clarified E1/E2 oligomerization and glycosylation patterns critical for fusion activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
816-1253
Protein Length
Full Length of Mature Protein
Species
Semliki forest virus (SFV)
Target Protein Sequence
YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT CTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS ASPSFVVSLCSARATCSASCEPPKDHIVPYAASHSNVVFPDMSGTALSWVQKISGGLGAF AIGAILVLVVVTCIGLRR
Uniprot No.

Target Background

Function

The Semliki Forest virus structural polyprotein forms an icosahedral capsid (T=4 symmetry) comprised of 240 copies of the capsid protein, enveloped by a lipid membrane containing 80 spikes of E1-E2 heterodimer trimers. The capsid protein binds viral RNA near a ribosome binding site, facilitating genome translation post-release. It possesses protease activity, autocatalytically cleaving from the nascent structural protein. Following self-cleavage, transient ribosome association precedes viral RNA binding and rapid icosahedral core particle assembly. The nucleocapsid subsequently associates with the cytoplasmic domain of the spike glycoprotein E2 at the cell membrane, leading to budding and virion maturation. During infection, virions attach to target cells, undergo clathrin-mediated endocytosis, and fuse with the host endosomal membrane, releasing the nucleocapsid into the cytoplasm. Uncoating, potentially triggered by capsid protein-ribosome interaction, exposes the genomic RNA. The polyprotein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, evading innate immune responses before gene expression. Further functional aspects of individual components are described below:

  • E3: Provides the signal sequence for E3/E2 precursor translocation to the endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, mediating pH protection during secretory pathway transport. Post-release, E3 is gradually released, priming the spike for low-pH activation.
  • E2: Plays a role in viral attachment via cell receptor binding. Synthesized as a p62 precursor, furin processes it at the cell membrane before budding, forming the E2-E1 heterodimer. The p62-E1 heterodimer is stable, unlike the unstable, low-pH-dissociating E2-E1. Late p62 processing prevents premature E1 fusion activation. E2's C-terminus, initially transmembrane, undergoes palmitoylation-mediated reorientation from lumenal to cytoplasmic, crucial for capsid protein interaction-mediated budding.
  • 6K: A constitutive membrane protein involved in glycoprotein processing, cell permeabilization, and viral budding. It disrupts endoplasmic reticulum calcium homeostasis, elevating cytoplasmic calcium. Its lipophilic nature suggests influence on lipid selection, affecting bilayer deformability during budding.
  • E1: A class II viral fusion protein. E1's fusion activity is inactive while bound to E2 in mature virions. Endosomal acidification post-cell attachment and endocytosis induces E1/E2 dissociation and E1 trimerization, activating fusion and releasing the nucleocapsid. Fusion requires cholesterol and sphingolipids in the target membrane, optimal at a cholesterol-to-phospholipid ratio of approximately 1:2 and specific to sterols with a 3-beta-hydroxyl group.
Gene References Into Functions

Further research highlights specific functional aspects of the Semliki Forest Virus structural polyprotein components:

  1. E2 D-loop interaction with E1 promotes Alphavirus budding. (PMID: 29114027)
  2. E2 residue variations at positions 162 or 247 (lysine or glutamic acid) affect viremia and neuroinvasion efficiency. (PMID: 25972559)
  3. E3 mediates E1 pH protection during biogenesis via Y47-dependent interactions at the E3-E2 interface. (PMID: 23864626)
  4. The DI-DIII linker region plays a critical role in low-pH-dependent E1 refolding driving membrane fusion. (PMID: 21543498)
  5. Furin-cleaved E3 protects the spike from premature activation in acidic compartments, and its extracellular release primes the spike for low-pH activation. (PMID: 21430054)
  6. E1 D188K mutation blocks E1 trimerization, inhibiting entry and infection. (PMID: 20826687)
  7. The E1 ij loop and H230 residue are critical for alphavirus membrane fusion, suggesting a previously undescribed late fusion intermediate. (PMID: 15564465)
  8. Acid-induced dissociation from E2 causes SFV E1 to rapidly adopt a nontrimeric, lipid-interaction-incapable intermediate conformation. (PMID: 15919953)
  9. E1 H230A mutant rescue mutations are clustered in the hinge region, membrane-interacting tip, and E1 stem packing groove. (PMID: 16731950)
  10. The E1 stem is crucial for virus assembly and budding, likely due to its role in envelope protein lateral interactions. (PMID: 16971447)
  11. A model of E1 transformation into a fusogenic stage suggests that while the fusion loop is available, the spike shell and stalk deteriorate, with E1 and E2 maintaining close contact in the spike head. (PMID: 17192272)
  12. Low pH-triggered SFV E1 fusion with target cells is facilitated by the trans-negative voltage across the endosomal membrane following conformational changes. (PMID: 17686870)
  13. SFV E1 directly binds cholesterol. (PMID: 18632857)
  14. E1 H3A mutation impairs virus growth and increases the pH requirement for fusion; its location suggests regulation of low-pH-dependent E1 refolding during fusion. (PMID: 19244325)
  15. E1 D188K mutation blocks SFV fusion and infection. (PMID: 19692469)

Database Links

KEGG: vg:922351

Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the structural polyprotein of Semliki Forest virus and how is it processed?

The SFV structural polyprotein is synthesized as a precursor with the structure NH2-C-p62-6K-E1-COOH. This polyprotein undergoes cotranslational cleavage through multiple protease activities to release individual proteins. The capsid protein (C) is released first through its own autoprotease activity, followed by signal peptidase-mediated cleavage that releases p62, 6K, and E1 glycoproteins. The capsid protein contains a region that functions as a translational enhancer, providing high expression levels of the structural proteins . The cleaved capsid protein complexes with viral genomes to form nucleocapsid structures, while the spike proteins (p62 and E1) dimerize in the endoplasmic reticulum and are transported to the cell surface where budding occurs .

What specific roles does the capsid protein play in the viral life cycle beyond structural functions?

The SFV capsid protein (C) is a multifunctional 33 kDa protein containing 267 amino acids that performs several critical roles:

  • RNA binding: It exhibits both specific and non-specific affinity for single-stranded nucleic acids. The N-terminal region (amino acids 1-80), rich in basic residues especially lysine, mediates non-specific binding to RNA or even ssDNA molecules .

  • Specific packaging: It recognizes packaging signals in viral genomic RNA through binding to multiple high-affinity sites, ensuring selective packaging of viral RNA into new particles .

  • Autoprotease activity: It self-cleaves from the nascent polyprotein .

  • Translational enhancement: Sequences at the 5' end of the capsid gene function as translational enhancers .

  • Host cell interaction: Recent research indicates the capsid protein inhibits nonsense-mediated mRNA decay (NMD) in host cells, potentially as a viral strategy to modulate host cell responses .

This multifunctionality makes the capsid protein a central player in both viral replication and host-pathogen interactions.

How does the SFV expression system differ from other viral vector systems?

The SFV expression system represents a specialized approach among viral vectors with several distinguishing features:

  • Self-amplifying RNA (saRNA): The SFV system utilizes self-amplifying RNA technology where the viral replicon can significantly amplify its own expression in the cytoplasm without integration into the host genome .

  • High-level transient expression: The system produces extremely high levels of heterologous proteins due to the efficiency of the viral replicase machinery and the presence of translational enhancers .

  • Biosafety design: Modern SFV expression systems incorporate multiple safety features, including conditional infectivity and the two-helper RNA system, making them safer than many alternative viral vectors .

  • Broad host range: SFV can infect a wide variety of mammalian cells with high efficiency .

  • Limited duration of expression: The cytopathic nature of alphavirus replication typically results in expression for 24-72 hours before cell death, making it suitable for applications requiring potent but temporary expression .

These properties make SFV particularly valuable for applications requiring high-level transient expression, such as recombinant protein production, vaccine development, and certain gene therapy approaches.

What are the critical components needed to establish a functional recombinant SFV expression system?

A functional recombinant SFV expression system requires several essential components:

  • Vector replicon RNA: Contains the viral nonstructural proteins (nsP1-4) that form the replicase complex, the subgenomic promoter, and the gene of interest replacing the structural protein genes .

  • Helper RNA(s): Provides the structural proteins necessary for packaging the replicon into virus-like particles. Modern systems use either:

    • Single helper RNA with mutations (e.g., in p62 processing) to prevent generation of infectious particles , or

    • Two-helper RNA system separating capsid and spike proteins onto different RNA molecules to minimize recombination risk .

  • Transcription system: Typically uses SP6 or T7 RNA polymerase to generate capped RNA transcripts in vitro .

  • Producer cells: Usually BHK-21 or similar cells that support high transfection efficiency and robust SFV replication .

  • Activation mechanism: For conditionally infectious systems, a method to activate particles (e.g., chymotrypsin treatment) .

The careful optimization of these components is crucial for achieving high titers of recombinant particles while maintaining biosafety.

How have recombinant SFV expression systems evolved to address biosafety concerns?

The evolution of SFV expression systems demonstrates progressive improvements in biosafety:

  • First-generation system (SFV-helper-1): Used a single helper RNA encoding all structural proteins. This system had biosafety limitations due to RNA recombination generating replication-proficient viruses (RPVs) with relatively high frequency .

  • Conditional infectivity system (helper-2): Incorporated a mutation (S219A) in the p62 protein that prevented its normal proteolytic processing to E2, resulting in non-infectious particles that could be artificially activated by chymotrypsin treatment in vitro .

  • Two-helper RNA system: Separated the structural genes onto two different helper RNAs - one encoding the capsid protein and another encoding the spike proteins (p62-6K-E1). This dramatically reduced the probability of generating RPVs by requiring multiple recombination events .

  • Enhanced two-helper system: Further improved by:

    • Abolishing capsid protease activity through mutation

    • Engineering a foot-and-mouth disease virus 2A autoprotease sequence between the capsid translational enhancer and spike genes to maintain high expression levels while ensuring proper processing

The theoretical frequency of RPV generation in the advanced two-helper system with the S219A mutation is calculated to be less than 4.2 × 10^-17, making it exceptionally safe for laboratory applications .

What specific mutations have been most effective in creating conditionally infectious SFV particles, and what are their mechanisms?

The most effective and well-characterized mutation for creating conditionally infectious SFV particles is the S219A substitution in the p62 protein. This specific mutation works through the following mechanism:

  • The S219A mutation prevents the normal intracellular cleavage of p62 to E2 and E3 by host furin-like proteases during transport through the Golgi complex .

  • The presence of uncleaved p62 in the viral spike complex renders the produced particles non-infectious, as this cleavage is essential for viral fusion activity during cell entry .

  • The conditional infectivity can be restored by in vitro treatment with chymotrypsin, which artificially cleaves p62 into E2 and E3, activating the fusion capability of the virus .

The effectiveness of this approach lies in its ability to completely block the infectious cycle even if replication-proficient viral genomes are accidentally generated through recombination. This provides a critical biosafety advantage since any potential escape mutants would still contain the S219A mutation and remain non-infectious without external enzymatic activation .

What are the optimal methods for producing high-titer recombinant SFV particles using the two-helper RNA system?

Producing high-titer recombinant SFV particles using the two-helper RNA system requires careful optimization of several parameters:

  • RNA preparation and transfection:

    • Use high-quality, capped RNA transcripts (replicon and both helper RNAs)

    • Maintain precise molar ratios between replicon and helper RNAs (typically 1:1:1)

    • Electroporation is generally more efficient than chemical transfection methods for introducing multiple RNA species

    • BHK-21 cells typically yield the highest particle production, with optimal cell density of 1-2 × 10^7 cells/mL during electroporation

  • Culture conditions post-transfection:

    • Maintain transfected cells at optimal temperature (typically 37°C, though sometimes lower temperatures like 28°C may reduce nucleic acid contamination)

    • Harvest supernatant containing particles at 24-48 hours post-transfection, before extensive cytopathic effects occur

    • Use serum-free medium during virus production to simplify downstream purification

  • Particle concentration and purification:

    • Ultracentrifugation through sucrose cushions

    • Gradient purification for highest purity

    • Tangential flow filtration for large-scale preparations

With optimal conditions, titers of up to 8 × 10^8 particles per 10^6 cells can be achieved using the two-helper system . This represents comparable efficiency to earlier systems but with significantly enhanced biosafety.

How can researchers effectively verify that their recombinant SFV preparations are free from replication-proficient viruses (RPVs)?

Thorough verification of RPV-free status requires a multi-tiered testing approach:

  • Serial passaging test:

    • Infect fresh BHK-21 cells with the recombinant SFV preparation

    • Harvest supernatant after 48-72 hours and use to infect new cells

    • Repeat for 3-4 passages

    • Analyze final passage supernatant for infectious particles using plaque assays

    • Absence of plaques indicates no RPVs are present

  • Immunofluorescence analysis:

    • Infect cells with recombinant SFV preparation

    • Fix cells after 24-48 hours

    • Stain with antibodies against SFV structural proteins

    • Only cells from initial infection should be positive; absence of new positive cells in subsequent passages confirms no RPVs

  • RT-PCR detection:

    • Design primers specific for wild-type SFV genomic RNA regions that should be absent in properly engineered recombinant systems

    • Extract RNA from purified virus preparation and perform sensitive RT-PCR

    • Include appropriate positive and negative controls to ensure assay sensitivity

  • In vivo testing for particularly sensitive applications:

    • Inoculate mice with concentrated virus preparation

    • Monitor for signs of infection and collect blood samples

    • Test blood for viremia using plaque assay and RT-PCR

    • Absence of viremia confirms RPV-free status

The extensive analysis protocol established for the two-helper system has demonstrated detection limits of <4.6 × 10^-9 for RPV generation frequency, providing high confidence in biosafety when all tests are negative .

How can the SFV capsid protein be utilized for RNA delivery in research applications?

The SFV capsid protein offers unique capabilities for RNA delivery in research applications:

  • Direct RNA association capabilities:

    • The purified recombinant SFV capsid protein can associate with self-amplifying RNA (saRNA) in vitro through both specific and non-specific binding mechanisms

    • This association is maintained even after exposure to high temperatures, demonstrating remarkable stability

    • The capsid protein can associate with saRNAs even without packaging signals, though specificity is enhanced when signals are present

  • Cellular delivery mechanisms:

    • Capsid-RNA complexes can be efficiently taken up by macrophage cell lines (e.g., J774A.1)

    • The functional integrity of the complexed RNA is maintained, as demonstrated by successful expression of reporter genes like GFP

    • The capsid protein likely facilitates endosomal escape and cytoplasmic delivery of the associated RNA

  • Methodological approach:

    • Recombinant capsid protein can be expressed in bacterial systems (E. coli) and purified using standard chromatography techniques

    • Complexes are formed by mixing purified capsid protein with saRNA at optimized ratios

    • The resulting nucleoprotein complexes protect RNA from degradation while maintaining its functionality

This approach represents an alternative to lipid nanoparticles and other delivery systems for RNA therapeutics and vaccines, potentially offering advantages in terms of stability, cellular uptake, and rapid release of RNA in the cytoplasm .

What are the molecular mechanisms by which the SFV capsid protein interacts with host cell processes, such as nonsense-mediated mRNA decay?

Recent research has revealed complex interactions between the SFV capsid protein and host cell processes:

  • Inhibition of nonsense-mediated mRNA decay (NMD):

    • The capsid protein specifically inhibits nonsense-mediated mRNA decay, a cellular quality control mechanism that eliminates mRNAs containing premature termination codons

    • This inhibition occurs through a mechanism that is independent of the virus-induced global translation inhibition

    • When overexpressed alone, the capsid protein causes increased expression of several NMD target mRNAs

  • Interaction with host translation machinery:

    • The capsid protein has been identified in proteomics analyses as interacting with components of the cellular translation apparatus

    • These interactions likely contribute to the virus's ability to hijack host translation machinery for viral protein synthesis

    • Mass spectrometry analyses have identified specific host factors involved in translation, ribosome biogenesis, and RNA metabolism that interact with viral proteins

  • Potential mechanisms of NMD inhibition:

    • Direct interaction with UPF1, a key factor in the NMD pathway

    • Interference with the assembly or function of the NMD surveillance complex

    • Sequestration of essential NMD factors away from their normal sites of action

This manipulation of host RNA decay pathways likely provides advantages to the virus by stabilizing viral RNAs and potentially modulating host gene expression during infection. The specific, translation-independent effect of the capsid protein on NMD represents a novel viral strategy for interacting with host cells .

What factors influence the efficiency of structural polyprotein processing in recombinant SFV systems, and how can processing be optimized?

Several factors influence the efficiency of SFV structural polyprotein processing, which is critical for successful production of recombinant particles:

  • Sequence integrity of cleavage sites:

    • The capsid autoprotease domain requires specific residues for efficient self-cleavage

    • Signal peptidase cleavage sites between p62/6K and 6K/E1 must be maintained with proper signal sequences

    • Mutations in these regions can dramatically reduce processing efficiency

  • Translational enhancer function:

    • The enhancer sequence at the 5' end of the capsid gene significantly increases translation efficiency

    • When engineering two-helper systems, this enhancer must be properly incorporated before the spike protein genes

    • The FMDV 2A autoprotease sequence provides an elegant solution for maintaining enhancer function while ensuring removal of non-native sequences from spike proteins

  • Host cell factors:

    • Different cell types may contain varying levels of signal peptidase and other host proteases required for polyprotein processing

    • Temperature affects both protein folding and enzyme activity; optimization may require temperature adjustments during expression

    • Cellular stress responses induced by viral replication can influence protein processing machinery

  • Codon optimization:

    • Codon usage can affect translation speed, which in turn influences co-translational folding and processing

    • Strategic codon optimization that maintains appropriate translation kinetics can improve processing efficiency

Optimization strategies include:

  • Engineering constructs with precisely maintained cleavage sites and signal sequences

  • Incorporating the FMDV 2A sequence to separate enhancer elements from spike proteins

  • Testing different cell types and growth conditions

  • Careful monitoring of processing efficiency using Western blotting with antibodies against individual structural proteins

How do researchers address challenges with nucleic acid contamination when purifying recombinant capsid protein for RNA delivery applications?

Nucleic acid contamination presents a significant challenge when purifying recombinant capsid protein due to its inherent nucleic acid-binding properties. Researchers have developed several strategies to address this issue:

  • Expression temperature manipulation:

    • Lower expression temperatures (28°C versus 37°C) significantly affect nucleic acid contamination levels

    • Protein produced at 37°C shows reduced nucleic acid contamination compared to protein produced at 28°C, as visualized by reduced SYBR™ Gold staining

  • High-salt purification strategies:

    • Inclusion of high salt concentrations (>1M NaCl) in purification buffers can disrupt electrostatic interactions between the capsid protein and contaminating nucleic acids

    • Step-wise salt gradient elution during chromatography can selectively release bound nucleic acids while retaining protein binding

  • Nuclease treatments:

    • Strategic treatment with benzonase or other nucleases during purification

    • Incubation with RNase A and DNase I under controlled conditions that preserve the functional domains of the capsid protein

    • Multiple rounds of nuclease treatment may be necessary for heavily contaminated preparations

  • Specialized chromatography approaches:

    • Heparin affinity chromatography can help separate nucleic acid-free protein

    • Hydroxyapatite chromatography, which separates based on both charge and nucleic acid binding

    • Size-exclusion chromatography as a final polishing step to separate protein from any remaining nucleic acid fragments

  • Validation of nucleic acid removal:

    • UV spectroscopy (A260/A280 ratio) to monitor nucleic acid contamination

    • Specialized staining techniques like SYBR™ Gold to visualize contaminating nucleic acids

    • Functional testing to ensure purified protein retains RNA-binding capacity despite purification treatments

These strategies must be carefully balanced to maintain the functional integrity of the capsid protein while effectively removing contaminating nucleic acids, as complete removal may affect the protein's ability to associate with target RNA in delivery applications.

What are the emerging applications of recombinant SFV structural proteins in vaccine development and gene therapy?

Several promising research directions are emerging for recombinant SFV structural proteins:

  • Self-amplifying RNA (saRNA) vaccine platforms:

    • SFV-based saRNA vaccines encoding antigens from various pathogens show enhanced immunogenicity compared to non-amplifying mRNA

    • The capsid protein can be utilized as a specialized delivery vehicle for saRNA vaccines, potentially improving stability and cellular uptake

    • These approaches may offer advantages in terms of dose-sparing and duration of antigen expression

  • Targeted gene delivery systems:

    • Engineered SFV structural proteins with modified receptor binding domains can redirect virus tropism to specific cell types

    • Incorporation of targeting ligands into recombinant particles enables delivery to tissues that are normally not permissive for alphavirus infection

    • This approach holds promise for cancer gene therapy and treatment of neurological disorders

  • Heterologous display platforms:

    • The SFV envelope proteins can be engineered to display foreign antigens or targeting moieties

    • This creates versatile platforms for vaccine development and targeted delivery

    • The structural organization of SFV particles allows for multivalent display of engineered proteins

  • Combination with other delivery technologies:

    • Hybrid systems combining recombinant SFV structural proteins with lipid nanoparticles or polymer-based carriers

    • These approaches aim to combine the advantages of different delivery modalities

    • Potential for improved stability, enhanced cellular uptake, and reduced immunogenicity of delivery systems

These emerging applications leverage the unique properties of SFV structural proteins while addressing limitations of traditional viral vector systems, potentially leading to safer and more effective therapeutic and prophylactic interventions.

How might understanding the structural polyprotein processing of SFV inform the development of antivirals against medically relevant alphaviruses?

Insights into SFV structural polyprotein processing provide valuable opportunities for antiviral development against medically relevant alphaviruses:

  • Targeting capsid protease activity:

    • The capsid protein's autoprotease domain represents a specific viral target

    • Inhibitors of this protease could block the release of capsid protein from the polyprotein, disrupting virus assembly

    • Structure-based drug design approaches can leverage the conservation of this domain across alphaviruses

  • Interfering with signal peptidase cleavage sites:

    • The structural polyprotein relies on host signal peptidase for multiple cleavage events

    • Small molecules that alter the conformation of these cleavage sites without broadly affecting host signal peptidase could selectively inhibit viral processing

    • Peptide-based inhibitors mimicking altered cleavage sites show promise in early research

  • Disrupting p62 maturation:

    • The conversion of p62 to E2 by furin-like proteases is essential for infectivity

    • This process is already targeted in conditional systems using the S219A mutation

    • Therapeutically blocking this maturation step using small molecules or protein-based inhibitors could prevent virus spread in infected individuals

  • Targeting host factors involved in polyprotein processing:

    • Identification of specific host factors required for efficient polyprotein processing

    • Temporary modulation of these factors could provide a higher barrier to viral resistance

    • This approach may be effective against multiple alphavirus species simultaneously

  • Inhibiting capsid-RNA interactions:

    • Molecules that interfere with the specific RNA binding properties of the capsid

    • This could prevent nucleocapsid assembly without affecting most cellular RNA-binding proteins

    • Both the specific packaging signal recognition and non-specific RNA binding regions represent potential targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.