Recombinant Semnopithecus entellus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. Should you require dry ice packaging, please communicate this in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize fulfilling your request.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Semnopithecus entellus (Hanuman langur) (Presbytis entellus)
Target Names
Target Protein Sequence
MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAAVQQLDNVI DVITYSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRAWRVVAAIWVASVLFSTLFI AYCNHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLVVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for MSH (alpha, beta and gamma) and ACTH. The receptor's activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does recombinant MC1R protein preparation affect experimental outcomes?

Answer: Recombinant protein preparation can significantly impact experimental results and should be carefully controlled. Key considerations include:

ParameterRecommendationRationale
Expression systemE. coli for structural studies; mammalian cells for functional studiesE. coli provides high yields but may lack proper folding; mammalian cells provide proper post-translational modifications
Purification tagsHis-tag for initial purification; consider tag removal for functional studiesTags may interfere with protein-protein interactions or ligand binding
Storage bufferTris-based buffer with 50% glycerol at pH 8.0Maintains protein stability during freeze-thaw cycles
Storage conditionsAliquot and store at -20°C/-80°C; avoid repeated freeze-thaw cyclesPrevents protein degradation
ReconstitutionUse deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerolEnsures proper solubility and stability

For optimal results, researchers should validate protein functionality after preparation using binding assays with known agonists (α-MSH, ACTH) and measure downstream cAMP production to confirm signaling capability .

What expression systems are most suitable for functional studies of MC1R?

Answer: The choice of expression system depends on your research objectives:

For structural studies, E. coli systems provide high yields but may lack proper post-translational modifications. When using E. coli, codon optimization may be necessary for efficient expression of primate proteins.

For functional studies, mammalian cell lines (particularly HEK293) offer several advantages:

  • Proper protein folding and insertion into plasma membrane

  • Appropriate post-translational modifications

  • Native G-protein coupling machinery

When designing expression constructs, consider:

  • Including a cleavable tag for purification that can be removed to minimize interference

  • Using a strong promoter (CMV for mammalian cells) to ensure adequate expression levels

  • Incorporating a fluorescent protein tag for localization studies if needed

Western blot analysis should be performed to verify protein expression, with cell surface expression confirmed by cell surface biotinylation or flow cytometry .

How can researchers assess MC1R signaling dynamics in experimental models?

Answer: Evaluating MC1R signaling requires multiple complementary approaches:

  • cAMP Measurement:

    • Real-time cAMP assays using FRET-based sensors

    • Endpoint cAMP accumulation assays with competitive immunoassays

    • Phospho-CREB immunoblotting as a downstream readout

  • Calcium Mobilization:

    • Fluorescent calcium indicators (Fluo-4, Fura-2)

    • Aequorin-based bioluminescence assays

  • ERK Pathway Activation:

    • Phospho-ERK immunoblotting

    • ERK-dependent transcriptional reporter assays

  • PI3K/AKT Signaling:

    • Phospho-AKT immunoblotting

    • PIP3 accumulation assays

Studies with MC1R have demonstrated that the canonical signaling pathway involves cAMP/protein kinase A (PKA), which promotes eumelanogenesis and protection from oxidative damage. More recent research has uncovered additional signaling through ERK pathways, PI3K/AKT, and connections to PPAR-γ .

When comparing signaling between species variants, use concentration-response curves rather than single-concentration experiments to accurately assess potency and efficacy differences.

What are the key considerations for studying MC1R polymorphisms across species?

Answer: When investigating MC1R polymorphisms across species, researchers should:

  • Sequence Analysis Approaches:

    • Use phylogenetic analysis to identify conserved regions

    • Apply SIFT and PolyPhen tools to predict functional impacts of variants

    • Classify variants as either major functional disruptions (R) or minor effect variants (r)

  • Functional Assessment Methods:

    • Measure cAMP production in response to α-MSH stimulation

    • Assess receptor surface expression using cell-surface biotinylation

    • Evaluate ligand binding kinetics using radioligand binding assays

  • Experimental Design Considerations:

    • Include wild-type MC1R as positive control

    • Test multiple ligand concentrations to generate complete dose-response curves

    • Assess both basal and stimulated activity

Research has shown that certain MC1R variants significantly impair signaling for cAMP production, with some resulting in complete loss-of-function. These functional effects correlate with pigmentation phenotypes, with the most severe variants associated with red hair in humans and altered coat colors in other mammals .

How does MC1R expression correlate with melanoma progression, and what methodological challenges must researchers address?

Answer: Recent research has revealed a stepwise increase in MC1R expression during melanoma progression from benign nevi to primary and metastatic melanoma. Higher MC1R expression is associated with worse survival outcomes in both primary and metastatic melanoma patients.

Methodological Challenges and Solutions:

ChallengeSolutionTechnical Considerations
Quantification of MC1R expressionQuantitative immunofluorescence (QIF)Provides superior dynamic range compared to standard IHC; requires specialized equipment
Antibody specificityValidation with Western blot in cell lines with known MC1R expressionEssential to confirm antibody specificity; consider multiple antibodies targeting different epitopes
Threshold determinationMedian dichotomization approachNo biological basis exists for thresholding; statistical approaches require justification
Heterogeneity of expressionTissue microarrays with multiple coresUse multiple cores per tumor to account for intratumoral heterogeneity
MC1R polymorphismsConsider polymorphism effects on antibody bindingPolymorphisms may affect epitope recognition; use antibodies targeting conserved regions

In one comprehensive study, investigators employed quantitative immunofluorescence to measure MC1R expression in 225 benign nevi, 189 primary melanomas, and 271 metastatic melanomas. This approach demonstrated that 90% of nevi, 67% of primary melanomas, and only 38% of metastases had low MC1R expression. Furthermore, higher MC1R expression in primary melanomas was strongly associated with Breslow depth greater than 1 mm and worse 10-year survival (p = 0.0031) .

What experimental approaches can resolve contradictory findings regarding MC1R's role in immune modulation?

Answer: Contradictory findings regarding MC1R's immunomodulatory effects require systematic experimental approaches:

  • Cell-Specific Expression Analysis:

    • Single-cell RNA sequencing to identify MC1R-expressing immune populations

    • Flow cytometry with validated antibodies to quantify receptor protein levels

    • Lineage-specific knockout models to assess cell-autonomous effects

  • Functional Immunological Assays:

    • Mixed lymphocyte reactions to assess T-cell responses

    • Cytokine profiling using multiplexed assays (e.g., Luminex)

    • Chemotaxis assays for neutrophils and monocytes

    • In vivo inflammation models with wild-type vs. MC1R-variant mice

  • Mechanistic Studies:

    • Investigate CD86 expression changes in monocytes following α-MSH stimulation

    • Assess neutrophil chemotaxis in response to inflammatory mediators

    • Examine MC1R-derived peptide presentation by MHC molecules

Research has demonstrated that MC1R is expressed in various immune cells including helper T cells, natural killer cells, CD14+ monocytes, B cells, CD8+ T cells, and neutrophils. MC1R activation by α-MSH has been shown to downregulate CD86 expression in CD14+ monocytes and reduce neutrophil chemotaxis. Additionally, cytotoxic T-cell lymphocytes specific for MC1R-derived peptides have been identified in tumor-infiltrating lymphocytes .

How can researchers address the challenges of studying MC1R pharmacology across different primate species?

Answer: Comparative MC1R pharmacology across primate species presents several challenges:

  • Receptor Expression Systems:

    • Clone MC1R from multiple primate species into identical expression vectors

    • Use inducible expression systems to control receptor density

    • Establish stable cell lines for each species variant for consistency

  • Pharmacological Characterization:

    • Complete concentration-response curves for multiple ligands (α-MSH, ACTH, synthetic agonists)

    • Measure both binding affinity (radioligand binding) and functional potency (cAMP assays)

    • Assess receptor internalization and recycling kinetics

  • Structural Considerations:

    • Generate homology models based on related GPCRs with solved structures

    • Perform molecular dynamics simulations to identify species differences in ligand binding pockets

    • Design mutational studies to confirm key interaction sites

  • Data Analysis Approaches:

    • Calculate bias factors to identify pathway-selective effects

    • Use operational models to distinguish changes in affinity from efficacy

    • Perform phylogenetic analysis to correlate functional differences with evolutionary distance

The MC1R protein sequences from different primate species (e.g., Trachypithecus cristatus, Semnopithecus entellus) show high homology but contain specific amino acid differences that may affect ligand binding and signaling properties. These differences provide an opportunity to understand the evolutionary adaptation of melanocortin signaling across primates .

What are the latest methodological advances for studying MC1R's role in DNA repair and cancer biology?

Answer: Contemporary approaches to investigate MC1R's role in DNA repair and cancer include:

  • DNA Damage Response Assessment:

    • Comet assays to measure DNA strand breaks

    • Immunofluorescence for γ-H2AX foci to quantify double-strand breaks

    • UDS (unscheduled DNA synthesis) assays to measure nucleotide excision repair capacity

    • High-throughput sequencing to assess mutation spectra and signatures

  • Mechanistic Pathway Analysis:

    • Proximity ligation assays to detect protein-protein interactions in situ

    • CRISPR-Cas9 knockout/knockin approaches to create isogenic cell lines

    • Phosphoproteomics to map MC1R-dependent signaling networks

    • ChIP-seq to identify transcriptional responses regulated by MC1R signaling

  • Translational Research Methods:

    • Patient-derived xenografts from MC1R wild-type and variant melanomas

    • Radiopharmaceutical approaches targeting MC1R for imaging and therapy

    • Single-cell analysis of tumor biopsies to assess heterogeneity in MC1R expression

    • Correlation of MC1R status with response to immunotherapy

Recent research demonstrates that MC1R plays a role beyond pigmentation in DNA repair pathways. Upregulation of DNA repair pathways in melanoma has been linked with metastasis and poor patient prognosis. Clinical trials are now investigating MC1R as a radiopharmaceutical target for metastatic melanoma, with the efficacy of these agents depending on MC1R expression levels in patient populations .

How can researchers effectively study MC1R-targeted therapeutics in preclinical models?

Answer: Developing effective preclinical models for MC1R-targeted therapeutics requires:

  • Model Selection Considerations:

    • Genetically engineered mouse models expressing human MC1R variants

    • Patient-derived xenograft models that maintain MC1R expression

    • 3D organoid cultures from melanoma patients with different MC1R genotypes

    • Humanized mouse models for testing immune-related effects

  • Therapeutic Approaches to Evaluate:

    • Small molecule agonists/antagonists with optimized pharmacokinetics

    • Antibody-drug conjugates targeting MC1R

    • Radiopharmaceuticals for theranostic applications

    • Cell-based therapies like CAR-T cells targeting MC1R epitopes

  • Critical Assessment Parameters:

    • Target engagement (occupancy assays, PET imaging with labeled ligands)

    • Pharmacodynamic biomarkers (cAMP, phospho-CREB)

    • Efficacy measures (tumor growth inhibition, survival)

    • Safety evaluation (on-target effects in normal melanocytes)

  • Translational Considerations:

    • MC1R polymorphism effects on drug binding and efficacy

    • Patient stratification strategies based on MC1R expression levels

    • Combination approaches with standard-of-care therapies

    • Resistance mechanisms and biomarkers of response

Recent clinical trials are assessing MC1R as a radiopharmaceutical target for metastatic melanoma. The efficacy of these agents depends on MC1R expression within patient populations. MC1R's relatively limited expression profile outside of melanocytes makes it an attractive therapeutic target with potentially fewer off-target effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.