Recombinant Sendai virus Hemagglutinin-neuraminidase (HN)

Shipped with Ice Packs
In Stock

Description

Key Functional Roles

FunctionMechanismReferences
Receptor bindingBinds α2,3-linked sialic acids via a flexible sialic-acid-recognition site .
Receptor destructionCleaves sialic acids, preventing viral re-attachment and superinfection .
Fusion protein activationInteracts with F protein via the stalk region to trigger membrane fusion .

Receptor Inactivation Without Enzymatic Activity

Temperature-sensitive HN mutants (e.g., A262T+G264R+E461K) uncouple receptor binding from neuraminidase activity. At 39°C:

  • NA activity: Undetectable .

  • Receptor binding: Persistent binding to sialylated receptors blocks homologous superinfection .

  • Mechanism: Bound HN physically occludes receptors, independent of sialic acid cleavage .

Implications for Antiviral Strategies

HN’s dual functionality makes it a prime target for antiviral drugs. Current research highlights:

  • Receptor-binding inhibition: Prevents initial viral attachment.

  • NA activity blockade: Disrupts receptor destruction and viral release.

  • Stalk-targeted therapies: Could impair F activation and viral fusion .

Table 1: HN Mutant Properties

MutantNA Activity (39°C)Receptor InactivationSource
A262T+G264R+E461KUndetectableYes (binding-dependent)
Wild-type HNActiveYes (cleavage-dependent)

Table 2: Recombinant HN Applications

ApplicationPurposeReference
Structural studiesDeterming HN-F interactions and stalk conformation
Superinfection assaysAssessing receptor inactivation mechanisms
Vaccine developmentModeling viral entry and immune evasion strategies

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
HN; Hemagglutinin-neuraminidase; HN protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
59-575
Protein Length
Full Length of Mature Protein
Species
Sendai virus (strain Z) (SeV) (Sendai virus (strain HVJ))
Target Names
HN
Target Protein Sequence
SARQGYSMKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNS RDVIQMIDKSCSRQELTQHCESTIAVHHADGIAPLEPHSFWRCPVGEPYLSSDPEISLLP GPSLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMF PDLNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLK GRTKSHRYRNSEVDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQ QVSQDTCNEALKITWLGGKQVVSVIIQVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLG DRVYIYTRSSGWHSQLQIGVLDVSHPLTINWTPHEALSRPGNKECNWYNKCPKECISGVY TDAYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITH FGKGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES
Uniprot No.

Target Background

Function
The hemagglutinin-neuraminidase (HN) protein mediates Sendai virus attachment to sialic acid-containing cell receptors, initiating infection. HN receptor binding induces a conformational change in the fusion (F) protein, triggering membrane fusion. The neuraminidase activity facilitates viral spread by releasing mature virions from neuraminic acid-containing glycoproteins.
Protein Families
Paramyxoviruses hemagglutinin-neuraminidase family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.

Q&A

What is the dual function of Sendai virus HN protein and how does it contribute to the viral life cycle?

The Sendai virus Hemagglutinin-Neuraminidase (HN) protein exhibits two critical enzymatic activities that function at different stages of the viral life cycle. During initial infection, the hemagglutinin activity binds to sialylated receptors on the host cell surface, initiating the infection process . Later in the viral life cycle, the neuraminidase (NA) activity cleaves sialic acids from glycans, preventing newly synthesized HN from binding to cellular receptors and enabling efficient release of progeny virions .

This dual functionality creates an interesting biological paradox: the same protein must first recognize and bind to sialic acid receptors to facilitate infection but later destroy these same receptors to enable viral release. This temporal regulation of binding versus destruction represents a sophisticated viral strategy for efficient propagation.

How does Sendai virus HN binding to receptors affect superinfection?

Studies have demonstrated that Sendai virus HN binding to sialylated receptors can prevent homologous superinfection independent of neuraminidase activity . In experiments with temperature-sensitive HN mutants that lack detectable neuraminidase activity at elevated temperatures, cells remained protected against superinfection with homologous virus . This indicates that continuous binding of HN to cellular receptors physically blocks these receptors, preventing attachment of additional viral particles even without receptor destruction via NA activity .

This finding is particularly significant as it demonstrates that receptor inactivation can occur through physical occupation rather than requiring enzymatic destruction, providing insight into mechanisms of viral interference that were previously not well characterized.

What specific sialic acid linkages does Sendai virus HN preferentially recognize?

Sendai virus HN shows specificity for α2,3-linked sialic acids on host cell surfaces. Research using lectin blot assays has demonstrated that in SeV-infected cells, α2,3-linked sialic acids are specifically reduced, while levels of α2,6-linked sialic acids remain unchanged . This linkage preference explains why certain cells may be susceptible to SeV infection while others are resistant, depending on their surface sialic acid composition.

The linkage specificity also has implications for cross-species transmission and explains patterns of viral tropism observed in experimental models. This selective recognition forms the molecular basis for the species restriction observed with Sendai virus.

What methodologies are used to generate recombinant Sendai virus with modified HN proteins?

Generation of recombinant Sendai virus (rSeV) with modified HN proteins typically employs reverse genetics systems that have been refined over the past two decades. The process involves:

  • Construction of a complete cDNA clone of the SeV genome (e.g., Fushimi or Enders strain)

  • Site-directed mutagenesis using techniques such as:

    • ExSite PCR-based mutagenesis

    • Fusion PCR technique

    • Standard cloning methods with synthetic oligonucleotide primers

  • Verification of desired mutations through nucleotide sequencing

  • Rescue of recombinant virus using helper plasmids expressing viral proteins and T7 RNA polymerase (often provided by MVA-T7 vaccinia virus)

For example, mutations in the SeV genome at positions 7,476, 7,482, and 8,073 (corresponding to amino acid changes at positions 262, 264, and 461 in the HN protein) have been generated using these approaches to create temperature-sensitive mutants with altered neuraminidase activity .

How can researchers evaluate neuraminidase activity of recombinant HN proteins?

Evaluation of neuraminidase activity in recombinant HN proteins involves several complementary approaches:

MethodPrincipleApplicationSensitivity
Colorimetric assaysMeasurement of chromogenic substrate cleavageQuantitative evaluation of NA activityModerate
Hemadsorption assaysBinding of erythrocytes to HN-expressing cellsAssessment of receptor binding capacityHigh
Homologous superinfection assaysProtection against infection with reporter virusFunctional assessment of receptor destructionVery high

The most sensitive approach involves homologous superinfection assays using a Sendai challenge virus carrying a reporter gene (such as eGFP) . In this method, cells expressing the HN variant of interest are challenged with a reporter virus, and successful superinfection (indicating lack of receptor destruction) is visualized through reporter gene expression .

Temperature-dependent neuraminidase activity can be evaluated by performing these assays at different temperatures (e.g., 32°C versus 39°C) to identify temperature-sensitive phenotypes .

What are key considerations when designing HN mutations for functional studies?

When designing HN mutations for functional studies, researchers should consider:

  • Structural domains: Mutations should target specific functional domains based on available structural information. The HN protein has distinct regions involved in receptor binding versus neuraminidase activity.

  • Conservation analysis: Compare sequences across parainfluenza viruses to identify conserved versus variable residues, which helps predict the functional importance of specific amino acids.

  • Previous mutation data: Build upon known mutations such as:

    • A262T+G264R+E461K, A262T+E461K, and A262T+G264R for temperature-sensitive neuraminidase activity

    • Q525R/K525Q affecting receptor binding and neuraminidase activity

  • Uncoupling strategies: Design mutations that selectively impair one function while preserving others (e.g., receptor binding without neuraminidase activity) .

  • Expression systems: Consider whether mutations might affect protein folding, surface expression, or stability, which can be assessed using immunofluorescence or flow cytometry.

How do specific amino acid changes in Sendai virus HN affect its neuraminidase activity?

Research has identified several key mutations that significantly alter HN neuraminidase activity:

  • Positions 262 and 264: Mutations A262T and G264R, corresponding to those found in temperature-sensitive mutant ts 271, result in reduced neuraminidase activity at elevated temperatures (39°C) while retaining activity at lower temperatures (32°C) .

  • Position 461: The E461K mutation further decreases neuraminidase activity when combined with the above mutations. This triple mutant (A262T+G264R+E461K) shows undetectable neuraminidase activity at 39°C despite maintaining receptor binding capability .

  • Position 525: The Q525R mutation (or K525Q) is associated with conformational changes in the receptor binding site and increased neuraminidase activity. This mutation appeared after passage in eggs and affects the balance between receptor binding and destruction .

These mutations provide valuable tools for investigating the structural basis of neuraminidase activity and its temporal regulation during viral infection. The ability to generate mutants with temperature-sensitive neuraminidase activity has been particularly useful for uncoupling receptor binding from receptor destruction.

What experimental evidence supports the role of HN in homologous interference?

Multiple lines of experimental evidence support the central role of HN in homologous interference:

  • Cell line studies: LLC-MK2 cells persistently infected with rSeV-EGFP showed resistance to superinfection with rSeV-sNluc, while remaining susceptible to heterologous viruses like human parainfluenza virus 2 (hPIV2) and influenza A virus (IAV-WSN) .

  • Protein expression experiments: LLC-MK2 cells expressing only the HN protein (without other viral proteins) displayed resistance to SeV superinfection similar to persistently infected cells. In contrast, cells expressing F or M proteins remained fully susceptible .

  • Sialic acid analysis: Lectin blot assays revealed that α2,3-linked sialic acids (the primary receptors for SeV) were specifically reduced in SeV-infected cells, while α2,6-linked sialic acids remained unchanged .

  • Neuraminidase-deficient mutants: Temperature-sensitive HN mutants lacking neuraminidase activity at elevated temperatures still protected cells against homologous superinfection, indicating that binding alone can mediate interference .

Together, these findings conclusively demonstrate that HN mediates homologous interference through both receptor destruction (via neuraminidase activity) and receptor occupation (through continuous binding).

How does the HN-receptor complex contribute to receptor inactivation without neuraminidase activity?

The discovery that neuraminidase-deficient HN mutants can still prevent superinfection revealed a novel mechanism of receptor inactivation. In temperature-sensitive mutants with undetectable neuraminidase activity at 39°C, the HN protein remained bound to sialylated cell-surface components . This continuous binding effectively shields receptors from incoming viruses, preventing their attachment.

Importantly, treatment with exogenous neuraminidase could release the bound HN protein, confirming that the interaction is specifically with sialylated receptors and not due to non-specific membrane association . This demonstrates that physical occupation of receptors by HN represents a distinct mechanism of receptor inactivation that functions independently of enzymatic destruction.

This finding has broader implications for understanding viral interference mechanisms across the Paramyxoviridae family and provides insight into how persistent infections might be maintained through receptor modulation rather than receptor destruction.

How has recombinant Sendai virus expressing modified HN been used in vaccine development?

Recombinant Sendai virus has emerged as a promising vector platform for vaccine development against multiple respiratory pathogens:

  • hPIV-3 vaccines: Researchers have created rSeV vectors expressing either the F or HN genes from human parainfluenza virus type 3 (hPIV-3). These recombinant vaccines (rSeV-hPIV3-F and rSeV-hPIV3-HN) elicit robust immune responses against hPIV-3, which is a leading cause of serious respiratory illness in children .

  • RSV vaccines: SeV vectors have also been employed to create candidate vaccines against Respiratory Syncytial Virus (RSV), another major pediatric respiratory pathogen .

Several factors make SeV an attractive vaccine vector platform:

  • Natural host range restriction to rodents, enhancing safety in humans

  • Demonstrated ability to prevent hPIV-1 infections in non-human primates

  • Favorable safety profile in clinical trials

  • Capacity to elicit robust and durable immune responses

The approach of inserting heterologous viral genes into the SeV backbone leverages the strong immunogenicity of SeV while directing responses against the target pathogen's antigens.

What methods are used to measure and characterize viral interference mediated by Sendai virus HN?

Researchers employ several complementary approaches to measure and characterize HN-mediated viral interference:

  • Reporter virus superinfection assays: Primary infection with wild-type virus followed by challenge with a reporter virus (e.g., SeV P-eGFP or rSeV-sNluc) allows visualization or quantification of superinfection . Decreased reporter expression indicates interference.

  • FACS analysis: Flow cytometry can quantify the percentage of cells expressing viral antigens or reporter proteins, confirming infection status and measuring protection against superinfection .

  • Viral titer measurements: Quantification of viral replication in cell culture supernatants provides direct evidence of interference with viral propagation .

  • Lectin blot assays: Analysis of specific sialic acid linkages on cell surfaces before and after infection helps determine the mechanism of interference (destruction versus occupation of receptors) .

  • Heterologous virus challenge: Testing whether cells resistant to SeV remain susceptible to other viruses (e.g., hPIV2, IAV) that use different receptors or entry mechanisms helps distinguish between specific and non-specific interference mechanisms .

These methodologies have revealed that HN-mediated interference is specific to homologous viruses and operates primarily through modulation of sialylated receptors.

How can recombinant Sendai virus be used to study viral population dynamics and evolution?

Recombinant Sendai virus serves as an excellent model system for studying viral population dynamics and evolution:

  • Serial passage experiments: Sequential passage of SeV in animal models with different immunocompetence statuses (e.g., varied nutritional conditions) reveals how host factors influence viral evolution and virulence .

  • Deep sequencing analysis: Next-generation sequencing of viral populations during passage enables tracking of genetic changes, emergence of variants, and shifts in population diversity .

  • Computational modeling: Mathematical models can be applied to sequencing data to predict evolutionary trajectories and identify selection pressures .

  • Cross-species transmission studies: Passage of SeV between different host species (e.g., from mice to guinea pigs) allows investigation of adaptive changes required for cross-species transmission .

These approaches have revealed important insights, including:

  • The N1124D mutation in the polymerase gene emerged consistently by passage 10 in multiple animals and was associated with increased virulence

  • Mutations in the HN gene (including at positions 454, 461, and 525) appeared during passage and affected virulence phenotypes

  • Host nutritional status influenced viral evolution trajectories and the virulence of resulting viral populations

Such studies provide a controlled experimental system for understanding fundamental principles of viral evolution that may apply more broadly to emerging pathogens.

How do HN binding and neuraminidase activities coordinate temporally during viral infection?

The temporal coordination between HN binding and neuraminidase activities represents one of the most intriguing aspects of paramyxovirus biology. Advanced research has revealed several regulatory mechanisms:

  • Conformational switching: Evidence suggests that HN can adopt different conformational states that favor either binding (hemagglutinin) or enzymatic (neuraminidase) activity depending on the infection stage.

  • Local sialic acid concentration: Early in infection, abundant sialic acid receptors favor the binding function. As local receptors become depleted through viral budding and cell damage, neuraminidase activity becomes more prominent.

  • pH dependence: While not conclusively demonstrated for Sendai virus, studies with related paramyxoviruses suggest that subtle pH changes in the microenvironment may influence the balance between binding and neuraminidase activities.

  • Oligomerization state: The quaternary structure of HN (tetramers versus dimers) may affect the relative strength of binding versus enzymatic functions.

Understanding this balance is crucial for designing antiviral strategies targeting HN. Future research should employ advanced techniques like single-molecule studies and real-time tracking of HN activity during the viral life cycle to further elucidate these regulatory mechanisms.

What are the methodological challenges in distinguishing receptor binding from receptor destruction in Sendai virus research?

Researchers face several methodological challenges when attempting to distinguish receptor binding from receptor destruction:

  • Temporal resolution: Traditional assays often lack the temporal resolution to capture the dynamic transition between binding and destruction. Real-time single-cell imaging approaches are needed to observe these processes as they unfold.

  • Quantitative measurement: Most assays provide qualitative or semi-quantitative results rather than precise measurements of binding affinity or enzymatic activity. Advanced biophysical techniques like surface plasmon resonance or bio-layer interferometry can provide more quantitative data.

  • Receptor heterogeneity: Cell surfaces display heterogeneous populations of sialylated receptors with varying affinities for HN. Methods that can distinguish between different receptor subtypes are essential.

  • Mutant design challenges: Creating mutants that completely separate binding from neuraminidase activity has proven difficult, as these functions often share structural determinants. Approaches using temperature-sensitive mutants have partially overcome this limitation .

  • Physiological relevance: In vitro assays may not accurately reflect the complexity of the in vivo environment. Development of more physiologically relevant 3D culture systems or organoid models would enhance the translational value of findings.

Research groups have addressed these challenges through innovative approaches, such as using reporter viruses for superinfection assays and developing temperature-sensitive mutants that allow conditional separation of binding and neuraminidase functions .

How might advanced structural biology techniques inform the development of next-generation Sendai virus vectors?

Advanced structural biology techniques offer tremendous potential for rational design of improved Sendai virus vectors:

Application of these techniques could lead to rationally designed vectors with:

  • Targeted tropism for specific cell types

  • Optimized expression of heterologous antigens

  • Enhanced immunogenicity profiles

  • Improved manufacturing characteristics

  • Tailored attenuation for specific applications

The combination of structural insights with reverse genetics capabilities makes SeV an exceptionally promising platform for next-generation vaccine and therapeutic development.

What are the most promising future applications of recombinant Sendai virus HN research?

Based on current research trajectories, several promising applications of recombinant Sendai virus HN research are emerging:

  • Multivalent respiratory virus vaccines: Building on successful expression of heterologous antigens, SeV vectors could be engineered to express antigens from multiple respiratory pathogens simultaneously, creating broad-spectrum vaccines.

  • Cancer immunotherapy platforms: The strong immunostimulatory properties of SeV make it an attractive vector for delivering tumor antigens or immunomodulatory molecules to stimulate anti-tumor immune responses.

  • Targeted oncolytic vectors: Modifications to HN receptor specificity could generate SeV variants that preferentially infect and lyse cancer cells with altered sialic acid profiles.

  • Gene therapy applications: The efficient respiratory tropism and transient expression characteristics of SeV make it potentially useful for gene delivery to respiratory epithelia for conditions like cystic fibrosis.

  • Viral evolution models: The well-characterized genetics and manipulability of SeV provide an excellent platform for studying fundamental principles of viral evolution that may apply to emerging pathogens.

The combination of reverse genetics capabilities, growing structural understanding, and established safety profile positions recombinant SeV as a versatile platform technology with diverse applications in both preventive and therapeutic contexts.

What are the unsolved questions regarding Sendai virus HN structure-function relationships?

Despite significant progress, several key questions about SeV HN structure-function relationships remain unanswered:

  • Conformational dynamics: How does HN transition between hemagglutinin-dominant and neuraminidase-dominant states? What structural changes mediate this switch?

  • Interaction with fusion protein: The precise mechanisms by which HN triggers the fusion protein (F) during viral entry remain incompletely understood.

  • Species specificity determinants: The molecular basis for SeV's host range restriction is not fully elucidated, particularly which aspects of HN-receptor interactions contribute to species barriers.

  • Antigenic evolution: How stable are the antigenic epitopes of HN during passage, and what structural constraints limit immune escape?

  • Quaternary interactions: The functional significance of HN oligomerization and potential interactions with other viral proteins on the virion surface requires further investigation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.