Recombinant Sensor histidine kinase CitA (citA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we currently have in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
citA; Sensor histidine kinase CitA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-547
Protein Length
full length protein
Species
Klebsiella pneumoniae
Target Names
citA
Target Protein Sequence
MSIYPMYTRKITHWFARRSFQNRIFLLILFTSTIVMLAMSWYLTDITEERLHYQVGQRAL IQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLYHVNPDEIGK SMEGGDSDEALINAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIEQLENWLS LQISSLLIPMAIMLLLLLFCARRFSLHIKKQMLNMEPQQLSQLLIQQSVLFESVFEGLIA IDSDYKITAINQTARRLLNLSQPEPTLIGKRISSVISQEVFFYDAPQTNKKDEIVTFNQI KVIASRMAVILNNEPQGWVISFRSKDDINTLSLQLSQVQQYADNLRAVQHEHRNLISTIA GLLFLKRYNQALELIQQQSESHQKVIDFIARNFQDNHLAGLLIGKYYRAKELGLELIFDP ACFVDRLPTALSHNEWISIVGNLLDNAYNASLRQPQGSKQIECLINSDGQEVIIEIADQG CGIDEALRDRIFERGVTSSASKDHGIGLWLVRSYVEQAGGSIVVENNIPFGTIFTLYIPL TRDEHHG
Uniprot No.

Target Background

Function
CitA is a member of the two-component regulatory system CitA/CitB. It is believed to activate CitB through phosphorylation. The periplasmic domain binds H-citrate(2-), which is crucial for the induction of citrate-fermentation genes.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CitA and what is its primary function in bacterial systems?

CitA is a membrane-bound sensor histidine kinase that functions as part of a two-component regulatory system (TCS) in bacteria, particularly in Klebsiella pneumoniae. It serves as a critical sensor for detecting extracellular citrate concentrations and transmitting this information across the cell membrane to regulate citrate transport and anaerobic metabolism . The CitA/CitB two-component system is essential for the induction of citrate fermentation genes, allowing bacteria to adapt to environmental conditions and utilize citrate as a carbon source . CitA represents a paradigmatic example of membrane-embedded histidine kinases that sense extracellular stimuli, making it an excellent model for studying transmembrane signaling mechanisms in bacterial sensory systems .

What are the key structural domains of CitA and their roles?

CitA consists of several distinct structural domains, each with specific functions in the sensing and signaling process:

  • Periplasmic sensor domain (PASp) - Located in the periplasmic space, this domain directly binds citrate with high specificity and functions as the primary sensor .

  • Transmembrane helices - CitA contains two transmembrane helices (TM1 and TM2) that anchor the protein in the membrane and participate in signal transmission .

  • Cytosolic PAS domain (PASc) - This domain undergoes conformational changes upon citrate binding to the periplasmic domain and plays a crucial role in signal transduction .

  • Linker domain - Connects the transmembrane regions to the kinase domain and participates in signal relay .

  • Kinase or transmitter domain - Contains the conserved histidine residue (H350) that undergoes autophosphorylation during the signaling process .

The structural arrangement allows CitA to detect extracellular citrate through its periplasmic domain and transmit this signal across the membrane to initiate appropriate cellular responses through the phosphorylation cascade .

How does CitA interact with its cognate response regulator?

CitA interacts with its cognate response regulator CitB through a phosphorylation-dependent mechanism. Upon citrate binding and activation, the kinase domain of CitA undergoes autophosphorylation at the conserved histidine residue (H350) . This phosphoryl group is subsequently transferred to an aspartate residue (D56) on CitB, activating the response regulator .

The interaction between CitA and CitB is highly specific, as demonstrated by experiments with mutant variants. When the phosphorylation site of CitB is mutated (D56N), it forms a stable complex with the kinase domain of CitA in the presence of ATP, indicating direct physical interaction between these proteins . This phosphotransfer mechanism allows for signal transmission from the sensor kinase to the response regulator, ultimately leading to changes in gene expression related to citrate metabolism .

What techniques are most effective for studying CitA structure and conformational changes?

Research on CitA has employed multiple complementary techniques to elucidate its structure and conformational dynamics:

  • Solid-state NMR - Critical for investigating membrane-embedded CitA in its native-like environment, providing insights into conformational changes that occur during signaling .

  • X-ray crystallography - Essential for determining high-resolution structures of CitA domains in different states. Crystal structures have revealed both anti-parallel and parallel dimer conformations of the cytosolic PAS domain (PASc) .

  • Solution NMR - Useful for studying soluble domains and their dynamics in solution, complementing crystallographic data .

  • Distance measurements with site-specific labels - Researchers have used 19F labels in the PASc domain to measure interdimer distances in the lipid-embedded protein, confirming conformational changes upon citrate binding .

  • Isothermal titration calorimetry - Valuable for determining binding parameters such as affinity, stoichiometry, and thermodynamic characteristics of citrate binding to the periplasmic domain .

The combination of these techniques has been particularly powerful, as each provides complementary information about different aspects of CitA structure and function in various environments .

How can recombinant CitA be effectively expressed and purified for in vitro studies?

For effective expression and purification of recombinant CitA, researchers have employed several strategies depending on the specific domain or construct of interest:

  • Periplasmic domain (CitAP) - The periplasmic domain (amino acids 45-176) has been successfully overproduced as a soluble cytoplasmic protein with a C-terminal histidine tag (CitAPHis) for purification using affinity chromatography .

  • Kinase domain - The CitA kinase domain (amino acids 327-547) has been expressed as a fusion protein with maltose-binding protein (MalE-CitAC), which showed constitutive autokinase activity and maintained the ability to phosphorylate CitB .

  • Full-length CitA - For studying the complete transmembrane signaling mechanism, full-length CitA has been expressed in lipid environments to maintain its native structure and function .

When expressing membrane proteins like CitA, careful optimization of expression conditions is crucial, including selection of appropriate expression systems (bacterial or cell-free), detergents for solubilization, and reconstitution methods if functional studies in membrane environments are desired .

What experimental approaches can be used to study the citrate binding properties of CitA?

Several experimental approaches have been employed to characterize the citrate binding properties of CitA:

  • Isothermal titration calorimetry (ITC) - This technique has been instrumental in determining the thermodynamic parameters of citrate binding to the periplasmic domain of CitA. ITC experiments have revealed that CitA binds citrate with high affinity (KD ~5 μM at pH 7) in a 1:1 stoichiometry .

  • Binding specificity assays - Comparative binding studies with various tri- and dicarboxylates have demonstrated that the periplasmic domain of CitA binds specifically to citrate but not to other structurally similar compounds .

  • pH dependency studies - Experiments at different pH values have indicated that CitA specifically recognizes the dianionic form of citrate (H-citrate2-), providing insights into the molecular basis of ligand recognition .

  • Metal ion influence studies - Investigations in the presence of Mg2+ ions have shown increased dissociation constants, suggesting that the Mg-citrate complex is not effectively bound by CitA .

  • Structural studies with and without citrate - X-ray crystallography of the periplasmic domain in citrate-free and citrate-bound states has revealed significant conformational changes upon ligand binding, including a contraction of the sensor domain .

What is the molecular mechanism of CitA transmembrane signaling?

The transmembrane signaling mechanism of CitA involves a sophisticated sequence of conformational changes that propagate from the periplasmic domain to the cytoplasmic regions:

  • Citrate binding - The process begins when citrate binds to the periplasmic PAS domain (PASp), causing a considerable contraction of this sensor domain .

  • TM2 linker conformation change - This binding event causes the linker to transmembrane helix 2 (TM2) to adopt a helical conformation .

  • Piston-like movement - The conformational change triggers a piston-like pulling of TM2 across the membrane, transmitting the signal from the periplasmic space to the cytoplasm .

  • PASc domain rearrangement - This movement induces a quaternary structure rearrangement in the cytosolic PAS domain (PASc). Crystal structures and distance measurements have revealed that PASc undergoes an anti-parallel to parallel transition upon citrate binding .

  • Amplification - These coordinated changes convert Angstrom-scale structural alterations in the sensor domain into nanometer-scale shifts in the linker to the phosphorylation subdomain of the kinase .

  • Kinase activation - The conformational changes ultimately modulate the activity of the kinase domain, leading to autophosphorylation and phosphotransfer to the response regulator CitB .

This mechanism demonstrates how relatively small initial structural changes can be amplified through a series of conformational adjustments to regulate kinase activity .

How does the quaternary structure of CitA change during signal transduction?

The quaternary structure of CitA undergoes significant rearrangements during signal transduction:

  • Dimer conformation - CitA functions as a dimer, and crystal structures of the cytosolic PAS domain (PASc) have revealed both anti-parallel and parallel dimer conformations .

  • Citrate-induced transition - Upon citrate binding to the periplasmic domain, the PASc domain undergoes a transition from an anti-parallel to a parallel dimer conformation .

  • Distance measurements - This conformational change has been confirmed through site-specific 19F labeling in the PASc domain, which allowed researchers to measure interdimer distances in the lipid-embedded protein before and after citrate binding .

  • Functional significance - The anti-parallel to parallel transition represents a key step in signal transduction, reorganizing the cytoplasmic domains to modulate kinase activity and downstream signaling .

  • Cooperative effects - These quaternary rearrangements likely occur cooperatively across the CitA dimer, ensuring coordinated signal transmission .

Understanding these quaternary structure changes is crucial for developing a comprehensive model of how sensor histidine kinases convert extracellular stimuli into intracellular responses .

What are the similarities and differences between CitA and other histidine kinases in terms of signaling mechanisms?

CitA shares several mechanistic features with other histidine kinases while also displaying unique characteristics:

Similarities:

  • Piston-like motion - The piston-like movement of the transmembrane helix observed in CitA is similar to that detected in the histidine kinase NarQ upon activation, suggesting a conserved mechanism for transmembrane signal transduction .

  • Domain organization - Like many other sensor histidine kinases, CitA contains periplasmic sensing domains, transmembrane helices, and cytoplasmic signaling domains arranged in a modular fashion .

  • PAS domain involvement - A large number of histidine kinases contain cytosolic PAS domains similar to CitA, suggesting that the findings regarding PASc dimer switching in CitA may be broadly applicable across bacterial histidine kinases .

Differences:

  • Connector domain arrangement - While CitA utilizes PAS domains as both its receptor and cytosolic connector domains, other histidine kinases like NarQ employ HAMP domains for these functions .

  • Cytoplasmic domain rearrangement - The lever-like rearrangement observed in the HAMP domain of NarQ is distinct from the structural rearrangement seen in the PASc domain of CitA upon activation .

  • Ligand specificity - CitA displays high specificity for citrate binding, particularly the dianionic form (H-citrate2-), which distinguishes it from other histidine kinases that sense different environmental stimuli .

These comparisons contribute to efforts toward formulating a uniform activation mechanism for bacterial histidine kinases while acknowledging their diverse sensory capabilities .

What are the current challenges in studying full-length CitA in membrane environments?

Researchers face several significant challenges when investigating full-length CitA in membrane environments:

  • Membrane protein expression - Obtaining sufficient quantities of properly folded, full-length membrane proteins like CitA remains technically challenging, often requiring optimization of expression systems, detergents, and purification protocols .

  • Reconstitution into lipid environments - For functional studies, CitA must be reconstituted into lipid environments that mimic its native membrane context, which can be technically demanding and may introduce artifacts .

  • Structural characterization - High-resolution structural analysis of integral membrane proteins is inherently difficult, necessitating specialized techniques like solid-state NMR in conjunction with other methods .

  • Dynamic measurements - Capturing the dynamic conformational changes that occur during signaling requires sophisticated biophysical approaches such as site-specific labeling and distance measurements in membrane-embedded contexts .

  • Full signaling pathway reconstruction - Understanding how the PASc dimer arrangement affects the structure of the dimerization and histidine phosphotransfer (DHp) domain in the context of full-length CitA remains an ongoing challenge .

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and structural biology techniques .

How can mutagenesis approaches be used to investigate CitA signaling mechanisms?

Mutagenesis has proven invaluable for dissecting the functional roles of specific residues and domains in CitA signaling:

When designing mutagenesis studies, researchers should consider using conservative substitutions to minimize structural disruption and employ multiple biophysical techniques to characterize the effects of mutations on both structure and function .

What are the implications of CitA research for understanding bacterial adaptation and potential antimicrobial targets?

Research on CitA provides valuable insights with broader implications:

  • Bacterial metabolic adaptation - Understanding how CitA regulates citrate metabolism offers insights into how bacteria adapt to changing nutrient availability, particularly in environments where citrate is an important carbon source .

  • Signaling pathway conservation - The mechanistic details revealed in CitA studies can be applied across a wide spectrum of bacterial histidine kinases, contributing to a unified model of bacterial signal transduction .

  • Antimicrobial target potential - Two-component systems like CitA/CitB are absent in mammals but essential for bacterial adaptation, making them attractive targets for novel antimicrobial compounds .

  • Structure-based drug design - The high-resolution structural information obtained for CitA domains provides templates for rational design of inhibitors that could disrupt bacterial signaling pathways .

  • Synthetic biology applications - Detailed knowledge of CitA signaling mechanisms could inform the design of synthetic biosensors or engineered signaling pathways for biotechnological applications .

By continuing to elucidate the molecular details of CitA function, researchers contribute not only to fundamental understanding of bacterial signaling but also to potential applications in medicine and biotechnology .

What are the optimal conditions for measuring CitA-citrate binding interactions?

Based on experimental findings, the following conditions are optimal for measuring CitA-citrate binding interactions:

  • pH conditions - Studies have shown that CitA preferentially binds the dianionic form of citrate (H-citrate2-), making pH 7.0 an optimal condition for binding assays .

  • Buffer composition - When performing binding studies, it's important to consider that Mg2+ ions significantly increase the dissociation constant, suggesting that Mg2+-free buffers may be preferable for initial characterization .

  • Protein preparation - The periplasmic domain (amino acids 45-176) with a C-terminal histidine tag (CitAPHis) has been successfully used for binding studies, providing a well-characterized system for investigating citrate interactions .

  • Measurement techniques - Isothermal titration calorimetry has proven effective for determining binding parameters, revealing a high-affinity interaction (KD ~5 μM) with 1:1 stoichiometry .

  • Negative controls - When designing binding experiments, researchers should include structurally similar di- and tricarboxylates as negative controls to confirm binding specificity .

These optimized conditions ensure reliable and reproducible measurements of the specific interactions between CitA and its ligand, citrate .

How can researchers effectively compare results across different CitA constructs and experimental systems?

To effectively compare results across different CitA constructs and experimental systems, researchers should consider several standardization approaches:

  • Domain boundaries - Clearly define and report the exact amino acid boundaries of the CitA constructs used, as slight variations can significantly impact protein behavior .

  • Expression tags - Account for the potential effects of affinity or solubility tags on protein structure and function, ideally performing control experiments with tag-cleaved constructs .

  • Membrane mimetics - When studying membrane-embedded constructs, document the specific lipid composition, detergents, or nanodiscs used, as these can influence protein behavior .

  • Reference standards - Include well-characterized constructs or conditions as internal standards to facilitate direct comparisons between different experimental setups .

  • Multiple techniques - Validate key findings using complementary techniques, such as combining structural data from crystallography with functional assays and biophysical measurements .

  • Data normalization - Develop standardized ways to normalize data (e.g., binding constants, conformational changes) that account for differences in experimental conditions .

By implementing these standardization practices, researchers can build a more coherent understanding of CitA function across various experimental contexts and facilitate integration of findings from different laboratories .

What advanced analytical methods can be used to investigate citrate-induced conformational changes in CitA?

Several sophisticated analytical methods have proven valuable for investigating the conformational changes that occur in CitA upon citrate binding:

  • Solid-state NMR spectroscopy - This technique is particularly powerful for studying membrane proteins like CitA in native-like lipid environments, providing atomic-level insights into structural changes .

  • Site-specific 19F labeling - Introduction of 19F labels at strategic positions combined with NMR or other distance measurement techniques allows precise tracking of conformational changes in specific regions of the protein .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) - This approach can identify regions of CitA that undergo changes in solvent accessibility upon citrate binding, revealing dynamic aspects of the conformational transition .

  • Single-molecule FRET - By labeling pairs of residues with fluorescent probes, researchers can monitor distance changes between specific regions of CitA in real-time during citrate binding .

  • Cryo-electron microscopy - For full-length CitA embedded in lipid environments, cryo-EM could potentially capture different conformational states and complement other structural approaches .

  • Molecular dynamics simulations - Computational methods can model the dynamic conformational changes that occur during citrate binding and signal transmission, providing hypotheses that can be tested experimentally .

The integration of these advanced analytical methods provides a comprehensive view of how citrate binding induces conformational changes that propagate through CitA to modulate its kinase activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.