Recombinant Sensor histidine kinase DcuS (dcuS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please inform us of any specific tag requirements; we will prioritize development accordingly.
Synonyms
dcuS; SF4098; S3632; Sensor histidine kinase DcuS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Shigella flexneri
Target Names
dcuS
Target Protein Sequence
MRHSLPYHILRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVA RTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPF KGDDILNALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSR WSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDD RGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRL LLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILG LLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSE SQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGI APDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGER SNR
Uniprot No.

Target Background

Function
Recombinant Sensor histidine kinase DcuS (dcuS) is a member of the two-component regulatory system DcuR/DcuS. It is involved in the C4-dicarboxylate-stimulated regulation of genes encoding the anaerobic fumarate respiratory system (frdABCD; nuoAN; dcuB; dcuC; sdhCDAB; etc.) and weakly regulates the aerobic C4-dicarboxylate transporter dctA. DcuS activates DcuR through phosphorylation.
Database Links

KEGG: sfl:SF4098

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sensor Histidine Kinase DcuS?

Sensor histidine kinase DcuS is a membrane-bound protein that functions as an integral component of bacterial two-component signal transduction systems (TCSs). Specifically, DcuS serves as a sensory modulator protein involved in detecting changes in environmental stimuli, particularly C4-dicarboxylates like fumarate. DcuS works in conjunction with its partner response regulator (RR) protein to effect appropriate adaptive responses, typically changes in gene expression that regulate carboxylate metabolism in bacteria such as Escherichia coli .

As a histidine protein kinase, DcuS becomes autophosphorylated at a conserved histidine residue in response to environmental signals, subsequently transferring this phosphoryl group to its partner response regulator at a conserved aspartate residue . This phosphotransfer triggers conformational changes in the response regulator, altering its affinity for DNA-binding or other cellular targets to produce an adaptive response to the original stimulus .

What is the structural composition of DcuS?

DcuS exhibits a complex multi-domain architecture that facilitates its sensory and signaling functions:

  • Two transmembrane helices (TM1 and TM2) that anchor the protein in the bacterial membrane

  • A periplasmic sensory PAS domain (PAS P or PDC domain) positioned between the transmembrane helices, which functions in signal detection

  • A cytoplasmic PAS domain (PAS C) located after TM2, which functions in signal transfer from the transmembrane region to the kinase domain

  • A C-terminal transmitter domain consisting of:

    • An N-terminal region with conserved α-helical regions containing the histidine phosphorylation site

    • A C-terminal catalytic HATPase (histidine kinase/ATPase) subdomain responsible for autophosphorylation

The structural integrity of these domains and their spatial organization are critical for proper signal detection and transmission. The PAS P domain specifically recognizes and binds effector molecules like fumarate, initiating the signaling cascade .

How does DcuS function in bacterial signal transduction?

DcuS functions through a precisely coordinated mechanism of signal detection and transmission:

  • Signal Detection: The periplasmic PAS P domain recognizes and binds specific effectors (primarily C4-dicarboxylates like fumarate)

  • Conformational Change: Effector binding induces compaction of the PAS P domain

  • Transmembrane Signal Propagation: The conformational change is transmitted across the membrane via a piston-type displacement of the TM2 helix

  • Cytoplasmic Signal Reception: The PAS C domain perceives the transmembrane signal from TM2

  • Kinase Activation: Signal transmission to the catalytic domain leads to autophosphorylation of DcuS at the conserved histidine residue

  • Signal Transfer: The phosphoryl group is transferred to the partner response regulator protein

  • Response Generation: The phosphorylated response regulator alters gene expression to produce an appropriate adaptive response to the original stimulus

This process demonstrates how DcuS effectively converts environmental chemical information into intracellular biochemical signals, allowing bacteria to adapt to changing conditions in their environment.

What are the primary signals that activate DcuS?

DcuS primarily responds to C4-dicarboxylates, with fumarate being a well-established effector molecule that has been extensively studied. Research has shown that the presence of fumarate or citrate increases the polar accumulation of DcuS by more than 20% . These carboxylates bind to the periplasmic PAS P domain, inducing conformational changes that propagate through the protein structure.

The binding of these effectors to DcuS is highly specific and represents the initial step in the signaling cascade. The effector-induced compaction of the PAS P domain creates energy optima that favor the repositioning of the transmembrane helices, particularly TM2, which is critical for signal transduction across the membrane .

What experimental methods are most effective for studying DcuS structure and function?

Several sophisticated experimental approaches have proven valuable for investigating DcuS:

  • Cysteine Accessibility Studies: The substituted Cysteine accessibility method (SCAM) combined with Cysteine scanning (Scan-SCAM) provides a high-resolution topology scan for transmembrane helices. This approach has been successfully used to study the topology of TM1 and TM2 in DcuS while maintaining structural and functional integrity of the system in vivo .

  • Oxidative Cysteine Cross-linking: This technique helps determine oligomerization states, dimerization interfaces, structural dynamics, flexibility, and relative positions of transmembrane helices. It has been applied to study quaternary structural changes in the DcuS homodimer during transmembrane signaling .

  • Fluorescent Protein Fusions: DcuS-YFP (yellow fluorescent protein) fusions enable live cell imaging through confocal laser fluorescence microscopy, facilitating studies of subcellular localization and distribution patterns. This approach has revealed polar accumulation of DcuS in bacterial cells .

  • NMR Spectroscopy: Nuclear magnetic resonance studies of DcuS sensory domains provide detailed structural information about conformational changes upon ligand binding .

  • Cell Fractionation: This technique complements microscopy studies to confirm subcellular localization findings .

These methods provide complementary data that, when integrated, offer comprehensive insights into DcuS structure-function relationships.

How can transmembrane signaling in DcuS be experimentally investigated?

Investigating transmembrane signaling in DcuS requires specialized approaches to capture dynamic conformational changes:

  • Cysteine Accessibility Approach:

    • Create a Cysteine-less version of DcuS (DcuS-C199S-C471S)

    • Introduce Cysteine residues at strategic positions through mutational replacement

    • Test accessibility of these Cysteine residues to membrane-impermeant thiol-reactive reagents

    • Compare accessibility patterns between inactive (OFF) and active (ON) states

  • Cross-linking Experiments for Quaternary Structure Analysis:

    • Use oxidative Cysteine cross-linking between protomers of the DcuS homodimer

    • Analyze disulfide bond formation patterns with and without effector molecules

    • Identify interfaces and conformational changes in the dimer structure

  • Engineered Charge Introductions:

    • Introduce charged amino acid residues into transmembrane helices

    • Observe shifts in TM2 positioning and correlate with functional changes in DcuS kinase activity

    • Validate findings through multiple complementary approaches

This multi-faceted experimental strategy has revealed that DcuS employs a piston-type movement of TM2 for transmembrane signal transduction, rather than rotational or scissors-like reorganization of the transmembrane helices .

What are the technical challenges in expressing and purifying recombinant DcuS?

Recombinant expression and purification of membrane proteins like DcuS present several significant technical challenges:

  • Membrane Protein Solubility: The hydrophobic transmembrane domains of DcuS make it inherently difficult to solubilize and maintain in solution without appropriate detergents or membrane mimetics.

  • Maintaining Proper Folding: Ensuring that recombinant DcuS retains its native conformation and functional activity, particularly when expressing the full-length protein rather than individual domains.

  • Oligomeric State Preservation: Since DcuS functions as a homodimer or higher oligomer, purification conditions must be optimized to maintain these quaternary structures .

  • Stability of Transmembrane Domains: Keeping the transmembrane helices stable during purification and subsequent experimental procedures.

  • Expression Systems: Selecting appropriate expression systems that can handle membrane protein overexpression without toxicity issues:

    • Using plasmid systems with modulated expression (e.g., pBAD derivatives) to control expression levels

    • Employing specialized E. coli strains designed for membrane protein expression

  • Fusion Tag Selection: Choosing appropriate fusion tags that facilitate purification without interfering with DcuS function or structure - evidence shows that C-terminal YFP fusions produce functional DcuS proteins .

Researchers have addressed these challenges through careful optimization of expression conditions and the development of specialized constructs, such as those described in the literature where DcuS was amplified from plasmids using PCR with specific oligonucleotide primers and cloned via flanking restriction sites into expression vectors .

How does DcuS oligomerization affect its function?

DcuS functions as a homodimer or higher oligomer regardless of its signaling state, with important implications for its sensory and signaling capabilities :

  • TM2 Helix Interactions: The transmembrane helix TM2 contributes significantly to DcuS dimerization, providing a structural framework for transmembrane signaling .

  • Symmetrical Signal Transmission: Upon activation by effector molecules like fumarate, both TM2 helices in the DcuS dimer undergo parallel displacement in a piston-type movement, ensuring coordinated signal transmission .

  • Continuous α-helical Structure: The periodicity observed in Cysteine cross-linking patterns for the PAS P-TM2 region (residues 172-186) indicates a continuous α-helix for α6 of PAS P and TM2, which plays a crucial role in homodimerization .

  • Signal Amplification: Dimerization may enhance signal sensitivity and amplification by allowing cooperative interactions between the two protomers.

  • Polar Localization: DcuS shows polar accumulation in bacterial cells similar to methyl-accepting chemotaxis proteins (MCPs), with fluorescence intensity at the cell poles 2.3-8.5 times higher than in the cytoplasm. This localization pattern may facilitate interaction with other signaling components .

Notably, experimental evidence indicates that DcuS-effector interactions can increase polar accumulation by more than 20%, suggesting that oligomerization and subcellular localization are dynamically regulated aspects of DcuS function .

What experimental design principles should be followed when studying DcuS?

When designing experiments to investigate DcuS, researchers should adhere to the following principles:

  • Clear Hypothesis Formulation: Develop well-defined hypotheses about specific aspects of DcuS structure, function, or signaling mechanisms based on current knowledge gaps .

  • Variable Control:

    • Independent Variable: Clearly define the manipulated variable (e.g., presence/absence of effector molecules, specific mutations in DcuS)

    • Dependent Variable: Establish precise measurements for the responding variable (e.g., autophosphorylation activity, conformational changes)

    • Controlled Variables: Rigorously maintain constant conditions for all factors that could influence results

  • Control Groups: Include appropriate controls for comparison with experimental conditions:

    • Negative controls (e.g., Cysteine-less DcuS variants)

    • Positive controls (e.g., known functional DcuS constructs)

  • Replicate Trials: Perform multiple trials to ensure reproducibility and statistical significance of findings .

  • Complementary Methodologies: Combine multiple experimental approaches to validate findings from different perspectives:

    • Structural studies (e.g., NMR, crystallography)

    • Functional assays (e.g., autophosphorylation assays)

    • In vivo studies (e.g., gene expression analyses)

    • In vitro reconstitution experiments

  • Quantitative Data Collection: Create appropriate tables for data recording with clearly labeled columns for independent and dependent variables, including units of measurement .

  • Methodological Documentation: Provide detailed step-by-step procedures using precise metric measurements to ensure reproducibility .

This systematic approach ensures that investigations of DcuS produce reliable, interpretable results that advance our understanding of bacterial signal transduction mechanisms.

How can DcuS research contribute to novel antibacterial strategies?

DcuS and other sensor histidine kinases represent promising targets for novel antibacterial agents due to several key factors:

  • Essential Signaling Role: As components of two-component systems (TCSs), sensor histidine kinases like DcuS are the main mechanism by which bacteria sense and respond to environmental changes, making them critical for bacterial adaptation and survival .

  • Target Specificity: The environmental signal detection mechanisms of specific SHKs like DcuS provide opportunities for targeting particular bacterial signaling pathways with minimal cross-reactivity .

  • Common Signaling Themes: The shared mechanisms of signal transmission across the membrane and propagation to catalytic domains present possibilities for developing broad-spectrum inhibitors that could target multiple SHKs simultaneously .

  • Screening Approaches: Intact SHKs could potentially be used in primary screening for inhibitors of enzyme activity, particularly in activity-based screening assays that currently employ domain fragments rather than intact kinases .

  • Verification Tools: SHKs serve as complementary tools to verify and further characterize initial inhibitor "hits" identified using whole-cell or reporter-based high-throughput screens targeting TCS signaling .

The detailed structural and functional understanding of DcuS transmembrane signaling mechanisms, particularly the piston-type movement of TM2, provides specific molecular targets for potential inhibitor design that could disrupt bacterial adaptation capabilities .

What methodological approaches can be used to study DcuS-effector interactions?

Investigating DcuS-effector interactions requires sophisticated methodological approaches:

  • In Vivo Functional Assays:

    • Monitor changes in gene expression controlled by the DcuS-DcuR two-component system in response to different effector molecules

    • Use reporter gene constructs to quantify signaling activity

    • Employ dose-response analyses to determine sensitivity thresholds

  • Structural Studies of Ligand Binding:

    • NMR spectroscopy to determine structural changes upon effector binding

    • X-ray crystallography of the periplasmic sensory domain with and without bound effector

    • Molecular dynamics simulations to model binding interactions and conformational changes

  • Mutagenesis Approaches:

    • Site-directed mutagenesis of predicted binding site residues

    • Binding site validation through functional characterization of mutants

    • Creation of altered specificity variants to probe binding site requirements

  • Biophysical Characterization:

    • Isothermal titration calorimetry (ITC) to determine binding affinities and thermodynamic parameters

    • Surface plasmon resonance (SPR) to study binding kinetics

    • Fluorescence-based binding assays using intrinsic tryptophan fluorescence or labeled ligands

  • Computational Methods:

    • Molecular docking to predict binding modes

    • Virtual screening to identify potential novel effectors

    • Quantitative structure-activity relationship (QSAR) analyses to correlate effector structural features with signaling outcomes

These approaches, when used in combination, provide comprehensive insights into the molecular basis of DcuS-effector interactions and how these interactions trigger the signaling cascade.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.