Recombinant Sensor histidine kinase QseE (qseE)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanism

QseE operates within a three-component system involving:

  • QseE: Autophosphorylates at a histidine residue upon ligand detection.

  • QseF: Response regulator phosphorylated by QseE; activates σ⁵⁴-dependent promoters (e.g., glmY in E. coli K-12) .

  • QseG: Outer membrane lipoprotein essential for QseE activity.

    • Interacts with QseE’s periplasmic loop (residues 50–68) via hydrogen bonding.

    • Ser58Asn mutation in QseE reduces QseG interaction and kinase activity .

Phosphorylation cascade:

  1. QseG binds QseE’s periplasmic domain, stabilizing its active conformation.

  2. QseE autophosphorylates in response to ligands (e.g., epinephrine).

  3. Phosphate transferred to QseF, enabling DNA binding and transcriptional activation .

Role in Pathogenesis

QseE/QseF regulates virulence in Enterobacteriaceae:

OrganismVirulence FunctionRegulated Genes/Pathways
EHECAttaching/effacing lesion formationespFu, LEE pathogenicity island
S. TyphimuriumEpithelial cell invasion, intramacrophage survivalsipA, sopB, SPI-1 T3SS
C. rodentiumHost colonizationUncharacterized effector genes
  • In EHEC, QseE indirectly inhibits the LEE locus by suppressing RcsB, a transcriptional repressor .

  • Epinephrine enhances QseE-dependent espFu expression by 2–3 fold, critical for actin pedestal formation .

Cross-Kingdom Signaling

QseE detects host-derived epinephrine to synchronize virulence with host stress:

  • EC₅₀: ~50 µM epinephrine in in vitro liposome assays .

  • In commensal E. coli K-12, epinephrine stimulates QseF phosphorylation only during stationary phase, requiring QseG .

Interaction Network

QseE integrates signals from multiple systems:

  • Cross-phosphorylation: Receives phosphate from non-cognate kinase QseC (epinephrine sensor) .

  • Regulatory crosstalk:

    • QseC/QseB TCS activates qseEF transcription.

    • QseF can be phosphorylated by QseC, KdpD, and other kinases .

Research Applications

Recombinant QseE is used to study:

  • Signal transduction mechanisms: In vitro autophosphorylation assays with radiolabeled ATP .

  • Drug discovery: Targeting QseE’s ATP-binding domain to disrupt bacterial signaling .

  • Structural biology: NMR and X-ray crystallography of the sensor domain .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. Please specify your required tag type for prioritized development.
Synonyms
qseE; yfhK; Z3833; ECs3422; Sensor histidine kinase QseE; Quorum-sensing regulator protein E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-475
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
qseE
Target Protein Sequence
WQAWQSLNALSDQAALVNRTTLIDARRSEAMTNAALEMERSYRQYCVLDDPTLAKVYQSQ RKRYSEMLDAHAGVLPDDKLYQALRQDLNNLAQLQCNNSGPDAAAAARLEAFASANTEMV QATRTVVFSRGQQLQREIAERGQYFGWQSLVLFLVSLVMVLLFTRMIIGPVKNIERMINR LGEGRSLGNSVSFSGPSELRSVGQRILWLSERLSWLESQRHQFLRHLSHELKTPLASMRE GTELLADQVVGPLTPEQKEVVSILDSSSRNLQKLIEQLLDYNRKQADSAVELDNVELAPL VETVVSAHSLPARAKMMHTDVDLKATACLAEPMLLMSVLDNLYSNAVHYGAESGNICLRS SLHGARVYIDVINTGTPIPQEERAMIFEPFFQGSHQRKGAVKGSGLGLSIARDCIRRMQG ELYLVDESGQDVCFRIELPSSKNTK
Uniprot No.

Target Background

Function
Recombinant Sensor histidine kinase QseE (qseE) is a component of the two-component regulatory system QseF/QseE, regulating virulence and metabolism in enterohemorrhagic *E. coli* (EHEC). It is essential for pedestal formation in host epithelial cells during infection. QseE autophosphorylates in response to epinephrine, sulfate, or phosphate, subsequently transferring the phosphate group to QseF.
Database Links

KEGG: ece:Z3833

STRING: 155864.Z3833

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is QseE and what is its biological significance?

QseE is a histidine kinase that functions within the QseEF two-component system in enterohemorrhagic Escherichia coli (EHEC). The biological significance of QseE lies in its critical role in bacterial pathogenicity, specifically in causing attaching and effacing (AE) lesions on epithelial cells. QseE acts as a sensor for multiple environmental signals including the host hormone epinephrine, sulfate, and phosphate, making it an important component in host-pathogen interactions. Upon sensing these signals, QseE regulates the QseF response regulator, which subsequently activates LEE gene expression responsible for the formation of AE lesions. This signaling cascade represents a key virulence mechanism that allows the bacteria to respond to the host environment and modulate its pathogenic capabilities accordingly .

How does the sensor domain of QseE function in signal transduction?

The sensor domain of QseE serves as the recognition site for environmental signals, initiating the signal transduction pathway. This domain directly interacts with ligands such as epinephrine, sulfate, and phosphate, which triggers conformational changes in the protein structure. These structural alterations propagate to the kinase domain, modulating its autophosphorylation activity. The phosphorylated histidine residue subsequently transfers the phosphate group to QseF, activating this response regulator. Structural studies reveal that the sensor domain predominantly adopts a helical conformation, which is likely critical for its function. The monomeric state of the sensor domain at pH 7.4-5.0 suggests that dimerization may occur upon ligand binding or involve other domains of the full-length protein. Understanding these structural transitions is essential for elucidating the molecular mechanism of signal recognition and transmission in this two-component system .

What experimental approaches are recommended for initial characterization of QseE?

Initial characterization of QseE should follow a systematic approach beginning with sequence analysis and homology modeling to predict structural features. For experimental characterization, recombinant expression in E. coli BL21(DE3) with an N-terminal 6×His tag has proven effective. When QseE forms inclusion bodies, a denaturation-refolding strategy using 7M guanidine hydrochloride followed by dialysis can recover properly folded protein. Purification should proceed through Ni-NTA affinity chromatography followed by size-exclusion chromatography to obtain homogeneous protein. Basic biophysical characterization should include circular dichroism (CD) to assess secondary structure content, confirming the predominantly helical nature of the sensor domain. Multi-angle light scattering (MALS) can verify the monomeric state of the protein under physiological conditions. For functional studies, ligand binding assays using fluorescence spectroscopy or isothermal titration calorimetry should be employed to determine binding affinities for known ligands such as epinephrine, sulfate, and phosphate .

What are the optimal conditions for recombinant expression of QseE?

The optimal conditions for recombinant expression of QseE involve strategic choices in expression vectors, host strains, and culture conditions. Based on published research, QseE sensor domain has been successfully expressed in E. coli BL21(DE3) using a vector containing an N-terminal 6×His tag for affinity purification. The protein tends to form inclusion bodies, which may actually be advantageous for high yield purification strategies. For expression, LB medium supplemented with appropriate antibiotics should be inoculated with transformed cells and grown at 37°C until reaching an optical density (OD600) of 0.6-0.8. Induction with IPTG (typically 0.5-1.0 mM) should then be performed, with post-induction growth at lower temperatures (16-25°C) for 12-18 hours to balance protein expression and solubility. For structural studies requiring isotope labeling, minimal media supplemented with 15N-ammonium chloride and/or 13C-glucose should be used instead of LB medium. The cells should be harvested by centrifugation and can be stored at -80°C until purification begins .

How can researchers effectively refold QseE from inclusion bodies?

Refolding QseE from inclusion bodies requires a carefully optimized protocol to achieve properly folded, functional protein. The process begins with thorough washing of inclusion bodies using buffer containing low concentrations of detergents (e.g., 0.5% Triton X-100) and denaturants (1-2M urea) to remove contaminants. Complete denaturation is then achieved using 7M guanidine hydrochloride, which has proven effective for QseE. The key to successful refolding lies in the gradual removal of denaturant through stepwise dialysis against buffers with decreasing concentrations of denaturant. A typical protocol would involve dialysis against buffer containing 4M, 2M, 1M, 0.5M, and finally 0M guanidine hydrochloride, each step performed for 12-24 hours at 4°C. The refolding buffer should contain additives that promote correct folding, such as L-arginine (0.4-0.8M), glycerol (5-10%), and redox pairs (reduced/oxidized glutathione) to facilitate proper disulfide bond formation if applicable. Throughout the refolding process, protein aggregation should be minimized by maintaining low protein concentration (0.1-0.5 mg/mL) and performing dialysis under gentle stirring conditions. Success of refolding can be monitored using CD spectroscopy to confirm the expected predominantly helical secondary structure of the QseE sensor domain .

What purification strategy yields the highest purity of functional QseE?

A comprehensive purification strategy for obtaining high-purity functional QseE involves multiple chromatographic steps tailored to the protein's properties. After refolding of the His-tagged QseE sensor domain from inclusion bodies, the first purification step should be immobilized metal affinity chromatography (IMAC) using Ni-NTA resin. The protein should be loaded onto the column equilibrated with binding buffer (typically containing 20-50 mM imidazole to reduce non-specific binding), followed by extensive washing to remove contaminants. Elution can be performed using a linear or step gradient of imidazole (typically 100-500 mM). Following IMAC, size-exclusion chromatography (SEC) is crucial for removing aggregates and ensuring monomeric protein. A Superdex 75 or similar column is appropriate for the QseE sensor domain, with running buffer optimized for protein stability (typically pH 5.0-7.4 based on stability studies). For highest purity, an additional ion-exchange chromatography step may be introduced between IMAC and SEC. Throughout purification, protein quality should be assessed by SDS-PAGE and Western blotting. Functional integrity can be verified using biophysical techniques such as CD spectroscopy to confirm secondary structure and NMR to assess tertiary structure. The final purified protein should yield a single band on SDS-PAGE and a monodisperse peak on SEC, with approximately 93% of expected backbone amide peaks visible in 1H-15N HSQC NMR spectra at pH 5.0, indicating a well-folded protein suitable for further structural and functional studies .

What spectroscopic methods are most informative for QseE structural studies?

Multiple complementary spectroscopic techniques provide comprehensive structural insights into QseE. Nuclear Magnetic Resonance (NMR) spectroscopy stands as the primary method for detailed structural analysis of the QseE sensor domain. The 1H-15N HSQC experiments at pH 5.0 have successfully detected approximately 93% of backbone amide peaks, providing sufficient signals for structural determination. This technique offers atomic-level resolution of protein structure and dynamics, making it invaluable for mapping ligand binding sites and conformational changes upon signal recognition. Circular Dichroism (CD) spectroscopy serves as an essential complementary technique for rapidly assessing secondary structure composition, confirming the predominantly helical nature of the QseE sensor domain. The CD spectra characteristic of α-helical proteins show negative bands at 222 nm and 208 nm with a positive band at 193 nm, which should be observed for properly folded QseE. Multi-Angle Light Scattering (MALS) provides critical information about the oligomeric state of QseE, confirming its monomeric nature in solution under physiological conditions. This technique is particularly valuable for validating sample homogeneity and detecting subtle changes in quaternary structure upon ligand binding. For monitoring ligand interactions, fluorescence spectroscopy utilizing intrinsic tryptophan fluorescence or extrinsic fluorescent probes can detect conformational changes upon ligand binding. Additionally, Fourier-Transform Infrared (FTIR) spectroscopy can provide complementary secondary structure information, particularly useful when sample conditions are not optimal for CD measurements .

How can researchers interpret NMR data to understand QseE structure and dynamics?

Interpreting NMR data for QseE requires systematic analysis of spectral features to extract structural and dynamic information. The 1H-15N HSQC spectrum serves as the protein's fingerprint, with each peak representing a backbone amide group. For QseE sensor domain, approximately 93% of expected backbone peaks are detectable at pH 5.0, indicating a well-folded protein suitable for structural studies. Researchers should first assign these peaks to specific residues using triple-resonance experiments such as HNCA, HN(CO)CA, HNCACB, and HN(CO)CACB. Chemical shift values provide initial insights into secondary structure elements, with characteristic patterns for α-helices (the predominant structure in QseE) versus β-sheets or random coils. Chemical shift indexing (CSI) or TALOS+ analysis can predict secondary structure elements with high accuracy. To investigate dynamics, 15N relaxation experiments (T1, T2, and heteronuclear NOE) should be performed, revealing regions of flexibility that may be important for ligand recognition or conformational changes. For ligand interaction studies, chemical shift perturbation experiments (monitoring changes in peak positions upon ligand addition) identify binding interfaces. Residues showing significant shifts likely participate in ligand binding or experience conformational changes upon binding. For more detailed structural information, NOE-based distance restraints combined with residual dipolar couplings (RDCs) and paramagnetic relaxation enhancement (PRE) data can generate high-resolution three-dimensional structures. Understanding the pH sensitivity of QseE is critical, as optimal spectral quality occurs at pH 5.0, while physiological conditions (pH 7.4) may present different structural features relevant to function .

What factors influence the stability and folding of QseE during structural studies?

Multiple factors critically influence the stability and folding of QseE during structural studies, requiring careful optimization for successful research. pH conditions significantly impact QseE stability, with optimal protein folding observed in the range of pH 5.0-7.4. At pH 5.0, NMR spectra reveal approximately 93% of backbone amide peaks, indicating well-defined structure, while maintaining physiological relevance requires validation of structural features at pH 7.4. Buffer composition plays a crucial role in stabilizing QseE, with phosphate or Tris buffers commonly used, potentially supplemented with stabilizing agents such as glycerol (5-10%) to prevent aggregation. The ionic strength of the buffer solution affects protein stability and ligand interactions, with typical concentrations of 100-150 mM NaCl providing a balance between stability and minimizing non-specific interactions. Temperature significantly impacts protein stability, with structural studies typically conducted at lower temperatures (4-25°C) to minimize thermal denaturation, though functional studies may require physiological temperatures (37°C) to capture relevant conformational states. The presence of ligands can substantially enhance QseE stability through induced fit or conformational selection mechanisms, making addition of known ligands (epinephrine, sulfate, phosphate) beneficial during purification and storage. Protein concentration must be carefully balanced, as higher concentrations increase signal intensity for spectroscopic techniques but also elevate aggregation risk, with optimal concentrations typically ranging from 50 μM to 1 mM depending on the specific technique. For long-term storage, flash freezing of QseE in the presence of cryoprotectants (10-20% glycerol) and storage at -80°C has been found to preserve structural integrity, though fresh preparations are preferable for high-resolution structural studies .

How can researchers investigate ligand binding mechanisms of QseE?

Investigating QseE ligand binding mechanisms requires sophisticated approaches to capture the molecular details of these interactions. Isothermal Titration Calorimetry (ITC) provides a direct, label-free method to determine thermodynamic parameters of binding, including dissociation constants (Kd), enthalpy changes (ΔH), and binding stoichiometry. For QseE, ITC experiments should be designed to test interactions with known ligands (epinephrine, sulfate, phosphate) under varying pH conditions (5.0-7.4) to understand environmental effects on binding affinity. NMR titration experiments offer residue-specific information on binding interfaces by monitoring chemical shift perturbations in 1H-15N HSQC spectra upon incremental addition of ligands. Residues showing significant chemical shift changes likely participate directly in ligand binding or undergo conformational changes upon binding. For QseE, these experiments are particularly informative at pH 5.0 where spectral quality is optimal. Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) provides kinetic information (kon and koff rates) in addition to binding affinities, offering insights into the binding mechanism. QseE should be immobilized via its His-tag on sensor chips while maintaining proper folding and accessibility of the ligand-binding interface. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) can map regions of QseE that become protected from solvent upon ligand binding, indicating conformational changes associated with binding events. Computational approaches, including molecular docking and molecular dynamics simulations, can predict binding modes and conformational changes, generating hypotheses for experimental validation. Site-directed mutagenesis of predicted binding site residues, followed by binding assays with the mutant proteins, provides definitive validation of the binding mechanism and identification of critical residues for ligand recognition and signal transduction .

What approaches help resolve challenges in studying QseE-QseF signal transduction?

Resolving challenges in studying QseE-QseF signal transduction requires integrated experimental strategies addressing the complexity of this two-component system. Reconstitution of the complete QseE-QseF system in vitro presents a foundational approach, requiring separate expression and purification of both proteins followed by controlled mixing experiments. Phosphotransfer assays using radioactive [γ-32P]ATP or phosphomimetic mutations (e.g., substituting aspartate residues with glutamate in QseF) help track the phosphoryl group transfer from QseE to QseF. FRET-based approaches can monitor protein-protein interactions and conformational changes in real-time, requiring careful fusion of fluorescent proteins or labels to QseE and QseF without disrupting function. For instance, researchers might fuse CFP to QseE and YFP to QseF, with FRET efficiency changes indicating interaction dynamics or conformational shifts. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides detailed mapping of protein-protein interaction interfaces and conformational changes by identifying regions with altered solvent accessibility upon complex formation. Surface plasmon resonance (SPR) offers quantitative kinetic and thermodynamic parameters of QseE-QseF interactions under varying ligand concentrations, helping elucidate how environmental signals modulate these interactions. For cellular contexts, bacterial two-hybrid systems or bioluminescence resonance energy transfer (BRET) assays in E. coli can validate interactions identified in vitro. Phosphoproteomic analysis using mass spectrometry allows identification of phosphorylation sites and potential additional targets beyond the canonical QseE-QseF pathway. Single-molecule techniques such as total internal reflection fluorescence (TIRF) microscopy with fluorescently labeled proteins can reveal the dynamics and stoichiometry of QseE-QseF interactions at unprecedented resolution. These approaches collectively address the central challenge of connecting structural changes in the QseE sensor domain to functional outcomes in bacterial pathogenicity .

How does pH influence the structural integrity and function of QseE?

The pH environment significantly impacts both the structural integrity and functional properties of QseE through multiple mechanisms that researchers must consider when designing experiments. NMR studies have demonstrated that the QseE sensor domain maintains a well-folded structure across the pH range of 5.0-7.4, with optimal spectral quality at pH 5.0 where approximately 93% of backbone amide peaks are detectable. This pH-dependent spectral quality reflects subtle conformational changes that may be functionally relevant. The predominantly helical secondary structure of QseE remains stable across this pH range, as confirmed by circular dichroism spectroscopy, suggesting that the core architectural elements are maintained despite changes in pH. The monomeric state of the QseE sensor domain persists throughout this pH range, indicating that oligomerization is not triggered by physiologically relevant pH shifts. At the molecular level, pH variations likely affect the protonation states of histidine residues (typical pKa ~6.0), which are often critical in histidine kinases both as phosphorylation sites and in ligand coordination. Researchers should conduct titration experiments to identify specific pH-sensitive residues that may function as molecular switches in signal transduction. Functionally, pH may modulate ligand binding affinities by altering the electrostatic surface potential of the binding pocket. For instance, the interactions with charged ligands like phosphate and sulfate would be particularly sensitive to pH changes. The optimal pH for enzymatic activity (autophosphorylation) of histidine kinases typically lies in the neutral range (pH 7.0-7.5), which correlates with the physiological environment of the bacterial cytoplasm. Understanding this pH-function relationship is crucial for designing relevant in vitro experiments that accurately reflect the in vivo behavior of QseE .

What emerging technologies might advance QseE research in the next five years?

Emerging technologies promise to revolutionize QseE research with unprecedented insights into structure, function, and regulation. Cryo-electron microscopy (cryo-EM) advancements, particularly single-particle analysis reaching near-atomic resolution, will likely enable visualization of full-length QseE in membrane environments, potentially capturing different conformational states during signal transduction. Integration with computational approaches through AlphaFold and RoseTTAFold will enhance structural predictions, particularly for regions challenging to resolve experimentally, accelerating structure-based experimental design. Time-resolved serial crystallography using X-ray free-electron lasers (XFELs) may capture transient conformational states of QseE during ligand binding and signal transduction with femtosecond temporal resolution, providing dynamic structural information previously inaccessible. Nanobody technology could generate crystallization chaperones that stabilize specific QseE conformations, facilitating structural studies of otherwise elusive states in the signaling cycle. Advanced single-molecule techniques, particularly single-molecule FRET (smFRET) combined with total internal reflection fluorescence (TIRF) microscopy, will likely reveal the conformational dynamics of individual QseE molecules during ligand binding and phosphorylation events. For cellular studies, super-resolution microscopy techniques (STORM, PALM) will visualize QseE localization and clustering within bacterial membranes with nanometer precision. CRISPR-Cas-based genome editing will enable precise genomic modifications for studying QseE function in native contexts, while cell-free expression systems may facilitate rapid screening of QseE variants. Mass photometry, a label-free technique detecting individual molecules, will provide insights into oligomerization states under various conditions. Native mass spectrometry combined with ion mobility will characterize QseE-ligand complexes in their native state without crystallization. Microfluidic systems for high-throughput screening will accelerate discovery of QseE modulators, potentially leading to novel anti-virulence strategies against EHEC infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.