Recombinant Sensor kinase CusS (cusS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is assigned during production. Please specify your desired tag type for preferential development.
Synonyms
cusS; c0656; Sensor histidine kinase CusS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
cusS
Target Protein Sequence
MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAEQDINDLKEISATLER VLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGAPDIREFTRDAIPDKDA QGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKPIYTLYIALSIDFHLHYI NDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQNITSKDLDVRLDPQTVPIE LEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLITQTEIALSQSRSQKELEDV LYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLADEVGKVFDFFEALAEDRGVEL RFVGDECQVAGDPLMLRRALSNLLSNALRYTPTGETIVVRCQTVDHLVQVTVENPGTPIA PEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVAHKGTVAVTSDVRGTRFVIILPA
Uniprot No.

Target Background

Function
Recombinant Sensor Kinase CusS (CusS) is a member of the two-component regulatory system CusS/CusR, involved in responding to copper and silver ions. It functions as a copper/silver ion sensor, activating CusR through phosphorylation.
Database Links

KEGG: ecc:c0656

STRING: 199310.c0656

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of CusS in E. coli?

CusS is a membrane-bound sensory histidine kinase that forms part of the CusRS two-component regulatory system in Escherichia coli. Structurally, TMHMM-based modeling predicts that CusS contains a periplasmic domain between amino acid positions 35 and 187, flanked by two transmembrane alpha-helices that anchor the protein in the cytoplasmic membrane . The protein's topology has been experimentally verified using C-terminal PhoA and LacZ protein fusions .

Functionally, CusS is responsible for sensing copper and silver ions in the periplasmic space. Upon binding to Cu(I), CusS undergoes a conformational change that activates its kinase domain, resulting in autophosphorylation . This phosphorylation initiates a signaling cascade that ultimately regulates copper homeostasis in the bacterial cell.

How does the CusRS two-component system work in copper homeostasis?

The CusRS system operates through a sophisticated phosphorylation cascade mechanism:

  • Copper ions (primarily Cu(I)) bind to the periplasmic sensor domain of CusS

  • This binding induces a conformational change, activating CusS's kinase activity

  • Activated CusS undergoes autophosphorylation and subsequently transfers the phosphate group to CusR (the response regulator)

  • Phosphorylated CusR activates the expression of the cusRS genes through the PcusR promoter and the cusCFBA genes through the PcusC promoter

  • The CusCFBA complex then functions to expel copper ions from both the cytoplasm and periplasm, maintaining cellular copper homeostasis

A notable feature of this system is that CusR production is boosted by phosphorylated CusR (CusR-P), creating a positive feedback loop that amplifies the response to copper exposure .

What are the key domains in CusS protein and their functions?

CusS contains several distinct functional domains:

  • Periplasmic domain (amino acids 35-187): This domain is responsible for sensing copper and silver ions. The structure of this domain (positions 38-185) has been solved, revealing key metal-binding sites .

  • Metal-binding sites: These include:

    • F43, H42, and H176 situated between alpha-helices that lead down to the cytoplasmic membrane

    • S84, M133, M135, and H145 located in a disordered loop of the periplasmic domain

  • Transmembrane alpha-helices: Two transmembrane regions anchor the protein in the cytoplasmic membrane and facilitate signal transduction between the periplasmic and cytoplasmic domains .

  • Cytoplasmic domain: Contains the catalytic histidine kinase activity responsible for autophosphorylation and subsequent phosphotransfer to CusR.

How do you verify the topology and localization of CusS in the bacterial membrane?

Researchers can verify CusS topology and membrane localization through several complementary approaches:

  • Fusion protein analysis: Construct C-terminal PhoA (alkaline phosphatase) and LacZ (β-galactosidase) protein fusions at various positions within the CusS polypeptide. PhoA is active in the periplasm, while LacZ is active in the cytoplasm. Measuring the activity of these reporter enzymes can confirm the predicted topology of CusS .

  • Western blotting: Express CusS as a Strep-tagged protein and perform western blotting on cellular fractions. CusS should be detected in the membrane fraction, confirming its localization to the cytoplasmic membrane .

  • Functional complementation: Verify that the tagged or modified CusS protein can restore copper resistance in a ΔcusS mutant strain, indicating proper folding and localization .

What experimental systems are commonly used to study CusS function?

Several experimental systems have proven effective for studying CusS function:

  • Growth inhibition assays: Measure bacterial growth in the presence of increasing copper concentrations to determine the IC50 (half maximal inhibitory concentration) in wild-type versus ΔcusS mutant strains .

  • Reporter gene assays: Use fluorescent proteins like sfGFP downstream of CusR-regulated promoters to quantify CusRS system activation in response to copper .

  • Anaerobic versus aerobic conditions: Test copper sensitivity under both conditions, as the CusRS system is particularly important under anaerobic conditions .

  • Genetic background variations: Study CusS function in various genetic backgrounds, such as ΔcopA (lacking the cytoplasmic copper exporter) or ΔcueO (lacking the periplasmic multicopper oxidase) .

  • In vitro binding assays: Use purified periplasmic domain to study metal binding and conformational changes directly .

How can you optimize expression and purification of recombinant CusS for structural and functional studies?

Optimizing recombinant CusS expression requires careful consideration of several factors:

  • Expression system selection: Use inducible expression systems with tunable promoters to control expression levels. Evidence shows that even without inducer (anhydrotetracycline), CusS can be detected in the membrane fraction, suggesting that low-level expression may help avoid inclusion body formation .

  • Protein tagging strategy: Utilize Strep-tagged CusS for efficient purification while maintaining protein functionality. Experimental evidence confirms that Strep-tagged CusS expressed from a plasmid can fully restore copper resistance in a ΔcusS mutant strain .

  • Domain-specific approach: For structural studies, consider working with just the periplasmic domain (positions 38-185), which has been successfully expressed and crystallized previously .

  • Membrane protein considerations: For full-length CusS, use appropriate detergents for solubilization from the membrane fraction while maintaining protein stability and activity.

  • Functionality verification: Always confirm that the recombinant protein retains its ability to complement a ΔcusS mutant before proceeding with detailed biochemical characterization.

What factors influence the sensitivity and specificity of CusRS-based biosensors?

Developing effective CusRS-based biosensors requires optimization of several parameters:

  • CusR and CusS expression levels: Adjusting the relative expression levels of CusR and CusS can significantly enhance biosensor performance. Research shows that overexpression of CusR increases output signal and optimizes detection performance .

  • Signal amplification strategies: Introducing the repL gene upstream of the reporter gene (e.g., sfGFP) can create a copy-number inducible plasmid system. In the presence of copper, the activated promoter increases RepL expression, boosting plasmid copy number and significantly amplifying the reporter signal .

  • Background signal management: The research indicates that introducing additional CusR can increase both signal and background levels due to potential cross-talk phosphorylation from other kinases. This trade-off must be carefully balanced .

  • Removal of copper detoxification genes: Deleting genes like cueO and cusCFBA can improve sensitivity and lower detection limits by preventing copper efflux from the cell .

  • Stability considerations: Relative standard deviation (RSD) measurements reveal that proper balancing of CusR and CusS expression leads to more stable biosensor performance with lower variation between replicates .

  • Cell culture optimization: Optimizing cell culture procedures can dramatically improve biosensor performance, with reports of increasing fold-change from 18-fold to approximately 100-fold at 1 μM copper concentrations .

How do mutations in key residues of CusS affect its sensing and signaling capabilities?

Mutational analysis of CusS has revealed several important structure-function relationships:

  • Metal-binding residues: Mutations in the key metal-binding residues (F43, H42, H176, S84, M133, M135, and H145) can alter the metal sensing capacity of CusS .

  • Histidine-rich stretch: Interestingly, the CusSΔ(129 to 138) derivative, which lacks the histidine-rich stretch, maintains full copper resistance equivalent to the wild-type protein, suggesting this region may not be essential for metal sensing .

  • Methionine triad region: In contrast, the CusSΔ(136 to 148) variant lacking the methionine triad shows reduced copper resistance compared to full-length CusS, though still significantly higher than the ΔcusS strain with empty vector. This indicates the methionine triad contributes to, but is not absolutely essential for, CusS function .

  • Phosphatase activity region: Mutations affecting the phosphatase activity of CusS can lead to altered signaling dynamics, potentially increasing background activation of the system .

When designing mutational studies, researchers should consider:

  • Using complementation assays in ΔcusS strains to assess functionality

  • Testing under both aerobic and anaerobic conditions

  • Measuring both metal binding and downstream signaling

  • Controlling for potential structural disruption versus specific functional changes

How can you investigate potential cross-talk between CusS and other two-component systems?

Cross-talk between two-component systems presents both challenges for specificity and opportunities for integration of cellular responses. To investigate cross-talk:

  • Background signal analysis: Measure activation of CusR-dependent reporters in the absence of copper stimulus. Elevated background signals can indicate cross-phosphorylation of CusR by non-cognate histidine kinases .

  • Genetic approach: Create strains lacking various histidine kinases and measure CusR activation in response to copper and non-copper stimuli.

  • Biochemical approach: Perform in vitro phosphorylation assays with purified CusS and non-cognate response regulators, or with CusR and non-cognate histidine kinases.

  • CusS overexpression effects: Research indicates that increased expression of CusS can lead to decreased fluorescence output from CusR-dependent reporters, potentially due to phosphatase activity affecting other signaling pathways .

  • Promoter specificity: Analyze the specificity of CusR binding to its target promoters versus promoters regulated by related response regulators.

Understanding these cross-talk mechanisms is critical for both fundamental knowledge of bacterial signaling networks and development of more specific biosensors.

What strategies can optimize the detection limit and dynamic range of CusRS-based biosensors?

Several strategies have proven effective for enhancing CusRS-based biosensor performance:

  • Signal amplification systems: Introducing copy-number inducible plasmids containing the repL gene can significantly amplify output signals. Research demonstrates that this approach increased the fold-change from 1.9-fold to substantially higher levels .

  • Genetic modifications: Removing copper detoxification genes (cueO and cusCFBA) can improve sensitivity by preventing copper efflux, allowing for detection of lower copper concentrations .

  • Optimized testing protocols: Enhanced analysis strategies have reduced detection limits to as low as 0.01 μM, surpassing traditional detection methods .

  • Balanced CusR and CusS expression: The research indicates that properly adjusting the expression levels of CusS and CusR significantly improves detection sensitivity. Too much CusS can reduce signal output, while increased CusR can enhance sensitivity, particularly at low copper concentrations (≤10 μM) .

  • Consideration of sensor stability: Evaluating the repeatability and stability of biosensors reveals significant correlations between CusS expression levels and sensor stability. Using constitutive promoters for CusS expression can enhance stability .

  • Cell culture conditions: Optimizing cell culture procedures can further improve performance, with some studies reporting increases in fold-change from 18-fold to approximately 100-fold .

What are the optimal conditions for studying CusS function in vitro and in vivo?

The following conditions have been established as optimal for CusS research:

How do you troubleshoot inconsistent results in CusS expression and function studies?

When encountering inconsistent results, consider these troubleshooting approaches:

  • Expression level variability:

    • Verify CusS expression levels by Western blotting

    • Ensure consistent induction conditions

    • Consider using constitutive promoters for more stable expression

  • Functionality verification:

    • Always confirm that recombinant CusS complements a ΔcusS mutant

    • Test under both aerobic and anaerobic conditions

    • Measure copper resistance using standardized protocols

  • Reporter signal issues:

    • High background: Check for cross-talk from other histidine kinases

    • Weak signal: Optimize CusR levels, as research shows CusR overexpression enhances response

    • Signal saturation: Consider the nonlinear relationship between fluorescence intensity and protein concentration when fluorescent protein levels exceed certain thresholds

  • Stability assessment:

    • Evaluate relative standard deviation (RSD) across multiple experiments

    • Test multiple independent colonies to account for biological variation

    • Consider testing data collected over multiple days to assess day-to-day variability

  • Metal specificity:

    • Ensure high-purity metal salts to avoid contamination

    • Control for oxidation state of copper (Cu(I) vs Cu(II))

    • Consider metal chelators to control free metal concentrations

By systematically addressing these potential sources of variability, researchers can establish more reliable and reproducible protocols for studying CusS function.

How should dose-response data for CusS-dependent systems be analyzed and presented?

Proper analysis and presentation of dose-response data is crucial for meaningful interpretation:

  • Normalization approaches:

    • Calculate fold-change (I/I0) relative to the no-copper control to account for background variation between experiments

    • For absolute measurements, present both raw values and normalized data

  • Statistical analysis:

    • Calculate standard deviation from multiple biological replicates

    • Determine relative standard deviation (RSD) by dividing standard deviation by average fluorescence intensity to assess stability

  • Detection limit determination:

    • Define limit of detection (LOD) as the lowest concentration producing a statistically significant response above background

    • Research shows that optimized CusRS-based biosensors can achieve LODs as low as 0.01 μM

  • Graphical presentation:

    • Use log scale for copper concentration given the wide dynamic range

    • Plot both absolute fluorescence values and fold-change data

    • Include error bars representing standard deviation from multiple replicates

  • Comparative analysis:

    • When comparing different sensor designs, present data in consistent formats

    • Consider showing fold-improvement relative to original designs

What controls are essential for validating CusS function in experimental systems?

Rigorous controls are necessary for reliable interpretation of CusS experimental data:

  • Genetic controls:

    • Wild-type strain (positive control)

    • ΔcusS deletion mutant (negative control)

    • ΔcusS complemented with functional CusS (complementation control)

    • ΔcusS with empty vector (vector control)

  • Expression controls:

    • Western blotting to confirm CusS expression and localization

    • Testing functionality of tagged versions (e.g., Strep-tagged CusS)

  • Specificity controls:

    • Test response to non-copper metals to confirm specificity

    • Include chelator controls to verify metal-dependent effects

  • System controls:

    • Test under both aerobic and anaerobic conditions

    • Compare responses in different media formulations

  • Reporter controls:

    • Include a constitutive fluorescent protein control to normalize for cell density

    • Test reporter constructs with constitutive promoters to verify reporter functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.