Recombinant Sensor-like histidine kinase senX3 (senX3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sensor-like Histidine Kinase SenX3 (SenX3)

Recombinant Sensor-like Histidine Kinase SenX3 (SenX3) is a sensor histidine kinase (HK) that is part of the two-component system SenX3-RegX3 in mycobacteria . This system plays a crucial role in sensing environmental phosphate (P$$ _i $$) levels and inducing genes required for P$$ _i $$ acquisition under P$$ _i $$-limiting conditions . SenX3 does not appear to sense P$$ _i $$ levels by itself .

SenX3-RegX3 Two-Component System

The SenX3-RegX3 system is a phosphorelay-based regulatory mechanism consisting of the SenX3 sensor histidine kinase and its cognate RegX3 response regulator . In Mycobacterium tuberculosis, this system is essential for adapting to changing environmental conditions, particularly phosphate availability .

Regulation of SenX3 Activity

The kinase/phosphatase activity of SenX3 is thought to be regulated by the functional state of the Pst uptake system, potentially with the help of auxiliary proteins like PhoU in Mycobacterium smegmatis and PhoY in M. tuberculosis . Inactivation of either the Pst transporter or PhoU/PhoY proteins via mutation leads to constitutive activation of the SenX3-RegX3 TCS and expression of the RegX3 regulon, irrespective of P$$ _i $$ availability .

The Pst transporter generates an inhibitory signal under P$$ _i $$-replete conditions that is transmitted by PhoU (PhoY) to the SenX3 HK, shifting the equilibrium of SenX3 activity from kinase to phosphatase mode and repressing the RegX3 regulon . PhoU and PhoY may act as adaptor proteins between the Pst transporter and SenX3 through interactions between the Per–ARNT–Sim (PAS) domain of SenX3 and the PstB ATPase subunit of the Pst system .

SenX3 as a Hemoprotein

SenX3 HK contains a b-type heme in its PAS domain . Oxidation of this heme from a ferrous to a ferric state enhances SenX3 autokinase activity, while binding of NO or CO to the heme inhibits autokinase activity, suggesting SenX3 can act as a sensor kinase for diatomic gases like O$$ _2 $$, NO, and CO .

Influence of PknB on RegX3 Transcriptional Activity

Overexpression of the kinase domain of Mycobacterium tuberculosis PknB (PknB-KD$$ _{Mtb} $$) can inhibit the transcriptional activity of RegX3 . PknB kinase activity inhibits the transcriptional activity of RegX3$$ _{Mtb} $$ through phosphorylation events at Thr-100, Thr-191, and Thr-217 .

Phosphorylation of Thr-191 and Thr-217 abolishes the DNA-binding ability of RegX3$$ _{Mtb} $$, and Thr-100 phosphorylation likely prevents RegX3$$ _{Mtb} $$ from being activated through conformational changes induced by SenX3-mediated phosphorylation . The convergence of the PknB and SenX3-RegX3 signaling pathways allows mycobacteria to integrate environmental P$$ _i $$ signals with the cellular replication state to adjust gene expression in response to P$$ _i $$ availability . Under favorable growth conditions, RegX3 is not activated by SenX3, and high PknB activity further inhibits RegX3, minimizing leaky expression of the RegX3 regulon .

SenX3-Independent Role of RegX3

M. tuberculosis strains disrupted in senX3 showed reduced regX3 expression during phosphate depletion and nutrient starvation . Although senX3 and regX3 are dispensable for Mtb growth in nutrient-rich broth, disruption of either gene caused a similar growth defect during phosphate depletion . Interestingly, a senX3 mutant, in which monocistronic regX3 expression is preserved, showed significantly higher survival relative to a regX3 mutant after nutrient starvation and in mouse lungs .

Impact on Gene Expression

ConditionDifferentially Regulated Genes (Fold Change > 1.5)
Static Cultures484
Microaerobic212
Anaerobic130

Deletion of RegX3 has the least effect on gene expression under anaerobic conditions, where it is expressed at its lowest level, and the most effect in static cultures, where it is expressed at its highest level .

Role in Butenyl-Spinosyn Biosynthesis

The SenX3-RegX3 system has a role in regulating butenyl-spinosyn biosynthesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
senX3; ML2440; B2168_C3_247; Sensor-like histidine kinase SenX3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Mycobacterium leprae (strain TN)
Target Names
senX3
Target Protein Sequence
MTVFSALLLAGVLSGLAFVVGIVAGIRLSPRLIERRQRLANEWAGITVLQMLQRIIALMP LGAAVVDTYRDVVYLNEQAKELGLVRDRQLDDQAWRAAQQALGGDDVEFDLLPGKRPAAG RSGLSVHGHARLLSEKDRRFAVVFVHDQSDYVRMEAARRDFVANVSHELKTPVGAMALLA EALLASADDAETVSRFAEKVLIEANRLGYMVAELIELSRLQGAERLPNVTDIDVDIIVSE AIARHKVAADTAAIEVRTDPPSGLRVLGDQTLLVTALANLVSNAIAYSPGGSLVSISRRR RGDNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHNGSI GVWSKPGTGSTFTLSIPAAMPLYQDNDEQSGQPRGCDMWLNRPQREEEEFKSMTPAQAMM QSEVTRGNVNDKCPDCGGRGIAG
Uniprot No.

Target Background

Function

Likely a component of the two-component regulatory system SenX3/RegX3. It phosphorylates RegX3.

Database Links

STRING: 272631.ML2440

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is SenX3 and what is its role in Mycobacterium tuberculosis?

SenX3 is a sensor histidine kinase that forms part of the SenX3-RegX3 two-component regulatory system in Mycobacterium tuberculosis. This system is involved in sensing environmental changes and regulating gene expression in response to these changes. Specifically, SenX3 functions as a sensor protein that detects oxygen levels, redox potential, and phosphate availability in the environment . Upon detection of these signals, SenX3 undergoes autophosphorylation at His167, and then transfers this phosphate group to the response regulator RegX3, which subsequently activates or represses gene expression . This system is crucial for M. tuberculosis virulence and adaptation to stress conditions during infection .

What domains does SenX3 contain and what are their functions?

SenX3 contains several functional domains:

  • Transmembrane domain: Located between residues 3-25, this single transmembrane helix anchors SenX3 to the cell membrane .

  • PAS-like domain: Located in the N-terminal region (residues 29-153), this domain functions as an oxygen and redox sensor . Unlike typical PAS domains, SenX3's PAS domain is atypical in that it lacks two helices, resulting in a more open structure .

  • Histidine kinase domain: Spanning residues 154-410, this domain contains the conserved histidine residue (His167) that is the site of autophosphorylation . This histidine residue serves as the phosphorylation site for subsequent phosphotransfer to RegX3 .

The PAS domain in SenX3 was identified through structural modeling techniques by comparing its sequence with known PAS domain-containing proteins, such as NifL from Azotobacter vinelandii and FixL, a known oxygen-responsive regulatory protein .

What ligands does SenX3 bind and how does this affect its function?

SenX3 binds to type b heme with a stoichiometry of approximately 0.7:1 . This heme binding allows SenX3 to function as a three-way sensor that responds to:

  • Oxygen (O₂): Oxidation of the SenX3 heme by oxygen leads to the activation of its kinase activity. When exposed to air, the Soret band shifts from 425 nm to 412 nm, indicating oxidation of the heme iron .

  • Nitric oxide (NO): Binding of NO to the deoxy-ferrous form of SenX3 results in the formation of a nitrosyl-heme complex (Soret band at 413 nm), which inhibits its kinase activity .

  • Carbon monoxide (CO): CO binding to the deoxy-ferrous form results in a carbonyl-heme complex (Soret band at 421 nm), which also inhibits kinase activity .

The UV-visible absorption spectrum of SenX3 shows characteristic features including a Soret band at 412 nm, an α band at 570 nm, and a β band at 539 nm, indicating the presence of a hexa-coordinated, high-spin heme .

How can recombinant SenX3 be expressed and purified for functional studies?

For expression and purification of recombinant SenX3, the following methodology can be employed:

  • Cloning: Amplify the senX3 gene using primers containing appropriate restriction sites. For instance, primers like Myc279 (5′-GGATCC-GCTGATTCACGCTCATC-3′) and Myc280 (5′-GGATCC-AATCCGGTGAACGTCGC-3′) for the 5′ side, and Myc297 (5′-GCGGCCGC-GTCAAACAGGTCACAAC-3′) and Myc282 (5′-GCGGCCGC-GTGCTGCAGAGCGCGGC-3′) for the 3′ side can be used .

  • Expression system: Clone the gene into an appropriate expression vector and transform into a heterologous host system.

  • Purification: The recombinant protein will have a reddish-brown color due to the presence of bound heme . Purification typically involves standard chromatographic techniques.

  • Verification: Verify the presence of heme in purified SenX3 using:

    • Visual inspection (reddish-brown color)

    • Oxidation by ortho-dianisidine in the presence of hydrogen peroxide in polyacrylamide gels

    • Pyridine hemochromogen assay to determine heme type and stoichiometry

    • UV-visible absorption spectroscopy (characteristic Soret band at 412 nm)

What methods can be used to assess the kinase activity of SenX3?

SenX3 kinase activity can be assessed using the following methods:

  • Autophosphorylation assay:

    • Divide aerobically purified SenX3 into two aliquots in an anaerobic glove box

    • Treat one aliquot with sodium dithionite (DTH) to generate the deoxy-ferrous form

    • Measure autophosphorylation through incorporation of radiolabeled phosphate from [γ-³²P]ATP

    • Analyze by gel electrophoresis and autoradiography to visualize phosphorylated protein

  • Effect of oxidants and ligands:

    • Test the effect of oxygen by exposing deoxy-ferrous SenX3 to air for 2 minutes

    • Test chemical oxidants like Fe(CN)₆³⁻ as an alternative to oxygen

    • Examine the effect of NO using NO donors like ProliNONOate

    • Examine the effect of CO using CO-releasing molecules (CORM-2) or CO-saturated PBS

  • Phosphotransfer to RegX3:

    • The phosphotransfer from phosphorylated SenX3 to RegX3 can be monitored similarly using radiolabeled ATP and analyzing the transfer of the phosphate group to RegX3

Results should show that the oxidized form of SenX3 (met-SenX3) has the highest kinase activity, while the deoxy-ferrous form shows moderate activity, and the NO-bound or CO-bound forms have inhibited activity .

What spectroscopic techniques are useful for characterizing SenX3-ligand interactions?

Several spectroscopic techniques can be used to characterize SenX3-ligand interactions:

  • UV-visible absorption spectroscopy:

    • For oxidized (met) SenX3: Soret band at 412 nm, α band at 570 nm, β band at 539 nm

    • For reduced (deoxy-ferrous) SenX3: Soret band at 425 nm, α band at 559 nm, β band at 529 nm

    • For NO-bound SenX3: Soret band at 413 nm, α band at 559 nm, β band at 530 nm

    • For CO-bound SenX3: Soret band at 421 nm, α band at 570 nm, β band at 537 nm

  • Pyridine hemochromogen assay: Used to determine the type of heme (type b) and the stoichiometry of heme binding (0.7:1)

  • Chemical probes: Using KCN to probe the redox state of the heme iron, as KCN only reacts with oxidized heme

  • Stability studies: Examining the stability of NO-bound and CO-bound forms in the presence of oxygen by monitoring spectral changes upon air exposure

These spectroscopic techniques provide valuable information about the redox state of SenX3 and its interactions with diatomic gases, which is crucial for understanding its sensory mechanism.

How can senX3 mutants be generated and validated for functional studies?

To generate and validate senX3 mutants for functional studies, the following approaches can be employed:

  • Deletion mutant construction:

    • Use homologous recombination techniques to replace the senX3 gene with an antibiotic resistance marker

    • Design deletion constructs that remove either the entire coding region or specific functional domains

    • For complete deletion, remove 15 bp upstream of senX3 and the whole coding region except for the carboxy-terminal 12 residues

  • Transposon insertion mutants:

    • Use transposon mutagenesis to insert a transposon (e.g., kanamycin resistance cassette) into the senX3 gene

    • Ensure insertion disrupts gene function while preserving surrounding genetic elements

  • Validation of mutants:

    • PCR amplification of the antibiotic resistance marker to confirm insertion

    • Southern blotting using digoxigenin-labeled probes specific to senX3

    • For Southern blotting, digest genomic DNA with appropriate restriction enzymes (e.g., FseI) and hybridize with senX3-specific probes

    • Expected fragment sizes: 5.7-kb for the senX3::Tn mutant vs. 3.7-kb for wild-type

  • Complementation:

    • Reintroduce the native senX3 gene using an integrative or replicative plasmid

    • For complete complementation, include the entire senX3-regX3 region with upstream sequences containing the native promoter

    • Confirm successful complementation by Southern blotting and PCR

What phenotypic assays can be used to characterize senX3 mutants?

Several phenotypic assays can be used to characterize senX3 mutants:

  • Growth assays:

    • Growth in nutrient-rich media (e.g., 7H9 broth with 25 mM phosphate)

    • Growth under phosphate-depleted conditions (e.g., 7H9 broth with 50 μM phosphate)

    • Growth during nutrient starvation

    • Expected results: senX3 mutants show normal growth in nutrient-rich conditions but impaired growth during phosphate depletion

  • Virulence assessment:

    • Mouse infection models (intravenous or aerosol infection)

    • Bacterial load determination in lungs and spleen at different time points (e.g., 1, 2.5, 3, and 5 months post-infection)

    • Expected results: senX3 mutants show significantly reduced bacterial loads (approximately 10-fold lower) compared to wild-type strains

  • Gene expression analysis:

    • qRT-PCR to measure expression of regX3 and phosphate-specific transport genes (e.g., pstC2)

    • RNA extraction from cultures grown under different conditions (nutrient-rich, phosphate-depleted, nutrient-starved)

    • Normalize gene expression to housekeeping genes like sigA

    • Expected results: Reduced expression of regX3 and pstC2 in senX3 mutants during phosphate depletion

  • Persistence assays:

    • Long-term survival studies in mice

    • Expected results: senX3 mutants persist for up to 5 months post-infection despite being attenuated

How does SenX3 interact with RegX3 for signal transduction?

The interaction between SenX3 and RegX3 involves several steps in the phosphotransfer mechanism:

  • Autophosphorylation: The redox state of the SenX3 heme determines its kinase activity. When the heme is oxidized by oxygen, SenX3 undergoes autophosphorylation at the conserved His167 residue using ATP as a phosphodonor .

  • Phosphotransfer complex formation: SenX3 and RegX3 form a complex that facilitates phosphotransfer. This interaction is primarily mediated by the DHp (dimerization and histidine phosphotransfer) domain of SenX3 and the receiver domain of RegX3 .

  • Phosphotransfer mechanism: The phosphoryl group is transferred from His167 of SenX3 to a conserved aspartate residue in RegX3. This transfer likely requires a conformational change in the His167 residue from an m conformation to a t conformation, bringing the Nε of His167 approximately 5.1 Å from the acceptor aspartate residue in RegX3 .

  • Phosphatase activity: SenX3 may also function as a phosphatase for RegX3~P, depending on phosphate availability, suggesting a dual role in both phosphorylation and dephosphorylation of RegX3 .

Structural modeling suggests that the interaction between SenX3 and RegX3 may resemble the Spo0B-Spo0F complex from Bacillus subtilis, with substantial surface burial into the interface (approximately 2250 Ų) and potential steric clashes between the X region of SenX3 and the loop between β4 and α4 of the response regulator .

What is the role of SenX3 in phosphate sensing and response?

SenX3 plays a crucial role in sensing and responding to phosphate (Pi) availability through the following mechanisms:

  • Phosphate sensing: SenX3, along with the Pst (phosphate-specific transport) system, senses environmental phosphate levels. When phosphate is abundant, the Pst system inhibits SenX3 activity, but this inhibition is relieved under phosphate-limiting conditions .

  • Activation of RegX3: Under phosphate-depleted conditions, SenX3 phosphorylates RegX3, activating its DNA-binding activity .

  • Regulation of phosphate acquisition genes: Phosphorylated RegX3 (RegX3~P) functions as a transcriptional activator for genes involved in phosphate acquisition, including phoA (encoding alkaline phosphatase) and the pst operon genes like pstC2 .

  • Dual functionality: SenX3 may function both as a phosphodonor (kinase) and phosphatase for RegX3, depending on phosphate availability, allowing fine-tuned regulation of the phosphate response .

Experimental evidence shows that:

  • senX3 mutants exhibit growth defects specifically during phosphate depletion but grow normally in phosphate-replete conditions

  • The expression of phosphate-specific transport genes like pstC2 is significantly reduced in senX3 mutants during phosphate depletion

  • Purified RegX3~P binds to promoter sequences of phosphate-responsive genes like phoA and senX3 itself, suggesting autoregulation of the system

How does SenX3 function as a three-way sensor for oxygen, nitric oxide, and carbon monoxide?

SenX3 functions as a sophisticated three-way sensor through its heme-binding capability, with different ligand interactions leading to different states of kinase activity:

  • Oxygen sensing (ON state):

    • When oxygen binds to the deoxy-ferrous form of SenX3, it oxidizes the heme iron

    • This oxidation shifts the Soret band from 425 nm to 412 nm

    • The oxidized (met) form of SenX3 exhibits enhanced autokinase activity

    • This represents the "ON" state that promotes phosphorylation of RegX3

    • The oxidation is rapid, occurring within 2 minutes of air exposure

  • Nitric oxide sensing (OFF state):

    • NO binding to the deoxy-ferrous form of SenX3 forms a stable nitrosyl-heme complex

    • This complex exhibits a Soret band at 413 nm

    • The NO-bound form shows inhibited kinase activity

    • The nitrosyl-heme complex is stable even in the presence of oxygen, locking SenX3 in the "OFF" state

  • Carbon monoxide sensing (OFF state):

    • CO binding to the deoxy-ferrous form creates a carbonyl-heme complex

    • This complex shows a Soret band at 421 nm

    • The CO-bound form also exhibits inhibited kinase activity

    • Like the NO-bound form, the carbonyl-heme complex is stable in the presence of oxygen

These different states allow M. tuberculosis to respond to varying environmental conditions:

  • Oxygen promotes active replication through SenX3 activation

  • NO and CO, which are produced during host immune responses, inhibit SenX3 activity and thereby contribute to the transition to a non-replicating persistent state

  • The stability of NO and CO complexes even in the presence of oxygen provides a mechanism to prevent reactivation of bacterial growth during ongoing immune responses

How does SenX3 contribute to Mycobacterium tuberculosis virulence and persistence?

SenX3 plays a significant role in M. tuberculosis virulence and persistence through several mechanisms:

  • Regulation of virulence genes: The SenX3-RegX3 system regulates various genes essential for virulence, including those involved in phosphate acquisition and potentially oxidative stress response .

  • Adaptation to host environments: As an oxygen, NO, and CO sensor, SenX3 helps M. tuberculosis adapt to changing conditions within the host, particularly the hypoxic and oxidative stress environments encountered in granulomas .

  • Contribution to persistence:

    • Mutants lacking senX3 show attenuated virulence but can persist in mouse lungs for up to 5 months post-infection

    • senX3 mutants show significantly higher survival compared to regX3 mutants during chronic infection in mice, suggesting that some RegX3 activity is preserved in senX3 mutants

    • Bacterial counts in mouse lungs and spleens are approximately 10-fold lower in animals infected with senX3 mutants compared to wild-type strains

  • Replication control: By sensing oxygen levels, SenX3 may function as an oxygen-controlled replication switch, promoting active replication in oxygen-rich environments and facilitating entry into a non-replicating state under hypoxic conditions .

These findings suggest that the SenX3-RegX3 system is a key component of M. tuberculosis adaptation to the host environment and contributes significantly to bacterial survival during infection.

Why are there discrepancies in virulence phenotypes between different senX3 mutant studies?

Several studies have reported varying phenotypes for senX3 mutants, which can be attributed to several methodological differences:

  • Strain differences:

    • Different laboratory strains of M. tuberculosis were used across studies

    • H37Rv contains three identical 77-bp mycobacterium interspersed repetitive units (MIRUs) in the senX3-regX3 intergenic region

    • CDC1551 contains two 77-bp MIRUs and one 53-bp MIRU

    • These structural differences may affect gene expression and regulation

  • Mutation strategies:

    • Complete deletion vs. transposon insertion

    • Some studies deleted the entire senX3 gene

    • Others inserted transposons at specific sites (e.g., bp 162 of the senX3 gene)

    • Different mutations may have varying effects on downstream regX3 expression

  • Complementation approaches:

    • Some studies complemented with the entire senX3-regX3 operon including the intergenic region

    • Others fused senX3 and regX3 by deleting the intergenic region

    • The presence or absence of upstream regulatory sequences (e.g., 211-bp upstream of senX3)

  • Infection models:

    • Intravenous infection vs. aerosol infection

    • Different mouse strains (though BALB/c mice were commonly used)

    • Different organs examined (lungs vs. spleen)

    • Different timepoints for bacterial load assessment

One specific example of these discrepancies is the comparative attenuation of senX3 and regX3 mutants. Some studies reported greater attenuation of senX3 deletion strains in mouse lungs relative to regX3 deletion strains, while others found higher survival of senX3 mutants compared to regX3 mutants during chronic infection .

How can SenX3 be targeted for tuberculosis drug development?

SenX3 represents a promising target for tuberculosis drug development for several reasons:

  • Essential role in virulence: SenX3 is required for full virulence of M. tuberculosis, making it a rational target for attenuating infection .

  • Unique structural features:

    • The atypical PAS domain in SenX3 lacks two helices, resulting in a more open structure compared to typical PAS domains

    • This unique structure could potentially be exploited for selective drug binding

    • The heme-binding pocket represents another potential target site for small molecule inhibitors

  • Potential targeting strategies:

    • Design of drugs that bind and disrupt the function of the atypical PAS domain

    • Development of compounds that interfere with heme binding or alter the redox properties of the bound heme

    • Creation of molecules that mimic the effects of NO or CO binding, locking SenX3 in an inactive state

    • Broad-spectrum antimicrobials that block two-component signal transduction systems

  • Vaccine development potential:

    • senX3 null bacteria show dramatic reduction in virulence but persist for up to 5 months post-infection

    • This persistence makes senX3 mutants potential candidates for live attenuated vaccines

    • Mutations in the senX3-regX3 system could be combined with other attenuating mutations to develop multivalent live vaccines

  • Advantage over existing targets:

    • Unlike some other potential targets in M. tuberculosis, SenX3's role in virulence has been well-established through multiple independent studies

    • The SenX3-RegX3 system is conserved across mycobacterial species but sufficiently different from human proteins, potentially allowing for selective targeting

How does monocistronic expression of regX3 occur in senX3 mutants?

The senX3-regX3 operon has a complex transcriptional organization that allows monocistronic expression of regX3 even in senX3 mutants:

This dual transcriptional control mechanism explains why senX3 mutants often show less severe phenotypes than regX3 mutants, as they retain some RegX3 function through monocistronic expression .

Is SenX3 primarily an oxygen sensor or a phosphate sensor?

The literature presents evidence for SenX3 functioning as both an oxygen sensor and a phosphate sensor, leading to some apparent contradictions. These can be reconciled by considering multiple sensing mechanisms:

  • Oxygen sensing evidence:

    • SenX3 contains a heme-binding PAS domain that directly interacts with oxygen

    • Oxygen oxidizes the heme iron, leading to enhanced kinase activity

    • NO and CO binding inhibit this activity, suggesting a role in oxygen/gas sensing

    • SenX3 shows sequence and structural similarity to known oxygen-sensing proteins like FixL

  • Phosphate sensing evidence:

    • senX3 mutants show specific growth defects during phosphate depletion

    • The SenX3-RegX3 system regulates phosphate acquisition genes like pstC2

    • RegX3~P binds to promoters of phosphate-responsive genes

    • The system shares functional similarities with other phosphate-sensing two-component systems

  • Integrated model:

    • SenX3 may function as a dual sensor that integrates both oxygen and phosphate signals

    • The PAS domain senses oxygen/redox conditions, while another domain or interaction with the Pst system senses phosphate availability

    • This dual sensing capability would allow M. tuberculosis to coordinate its metabolism and virulence in response to multiple environmental cues simultaneously

    • Phosphate limitation and hypoxia are both conditions encountered by M. tuberculosis in granulomas, suggesting evolutionary pressure for integrated sensing

  • Stress response connection:

    • Both phosphate limitation and hypoxia represent stress conditions

    • The SenX3-RegX3 system may have evolved to respond to multiple stress signals through different sensing mechanisms

    • This is supported by the finding that SenX3-RegX3 has similarity to the ArcB-ArcA system of E. coli, which is a global regulator of aerobic genes

What are the unresolved questions about SenX3 structure and function?

Despite significant advances in understanding SenX3, several important questions remain unresolved:

  • Complete three-dimensional structure:

    • While the PAS domain has been modeled, the complete three-dimensional structure of SenX3, particularly in complex with RegX3, has not been determined

    • Structural information would provide insights into the phosphotransfer mechanism and potential drug binding sites

  • Signal integration mechanism:

    • How SenX3 integrates signals from both oxygen/redox sensing and phosphate availability remains unclear

    • The structural basis for this dual sensing capability needs to be elucidated

    • The potential crosstalk between these signaling pathways requires investigation

  • Phosphatase activity regulation:

    • Although SenX3 may function as both a kinase and phosphatase, the mechanisms regulating the switch between these activities are not fully understood

    • The structural changes associated with phosphatase vs. kinase activity remain to be determined

  • Host interaction factors:

    • How host-derived signals beyond O₂, NO, and CO might influence SenX3 activity

    • The potential role of host phosphate sequestration in activating the SenX3-RegX3 system during infection

  • Temporal dynamics of sensing:

    • The kinetics of SenX3 response to changing oxygen and phosphate levels in vivo

    • How quickly SenX3 can switch between active and inactive states in response to environmental fluctuations

  • Interaction with other regulatory systems:

    • The potential cross-talk between SenX3-RegX3 and other two-component systems in M. tuberculosis

    • Integration with the DosS-DosT-DosR dormancy system, which also senses oxygen, NO, and CO

  • Role in antibiotic tolerance:

    • Whether SenX3-regulated persistence contributes to antibiotic tolerance

    • The potential for targeting SenX3 to enhance antibiotic efficacy against persistent bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.